SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225874389|ref|YP_002755848.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225874389|ref|YP_002755848.1|
Domain Number 1 Region: 10-237,423-494
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.81e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0019
Further Details:      
 
Domain Number 2 Region: 479-583
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.25e-23
Family Anticodon-binding domain of Class II aaRS 0.00099
Further Details:      
 
Domain Number 3 Region: 218-405
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 7.85e-21
Family YbaK/ProRS associated domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225874389|ref|YP_002755848.1|
Sequence length 585
Comment proline--tRNA ligase [Acidobacterium capsulatum ATCC 51196]
Sequence
MHRWSRLFVPTLREAPSDAEVASHKFLLRSGYIRQLGAGIYSYLLFGQRSINKIVGIVRE
EMDKIGQEFLLPAIHPADLWRESGRWTVMGDNMFRLKDRKGAELCLGMTHEEVMTDIARN
ELRSYKQLPQIWYQIQNKFRDEPRPRSGLLRVRQFLMKDSYSFDLNQAGLDKSYDLHDAA
YRAIFTRCGLNFVVVEADSGAMGGSGSQEFMVYTDAGEDLIASCAKCGYAANMEKATSKL
APVEELAATGDGQPELISTPGQAAIADICKFLGMQPHSDIKCVAYMAEVPSEDGKTSTWE
PVAAFLRGDHFVNETKLLAVVGATELRPMQAEELEKWMHGPAGYLGPVGLTPAKKLRDGS
LNVVLDLGLEGRRNLVAGANKLDYHYRNVTPGRDFTWTVAADIRNAAEGEGCPVCGEPLK
VAKAVEIGHIFKLGTKYTESMGARVLDENGKEVMPVMGCYGIGIERILTASIEQNNDANG
FWLPRSIAPFDVVVTITNMADETLRQAGEALAAQLEAAGYDVLLDDREERAGVKFKDADL
VGIPYRFNVGKKTLEGKTELVTRATASSQDVALDAAVEALKALTA
Download sequence
Identical sequences C1F3P3
240015.ACP_2832 gi|225874389|ref|YP_002755848.1| WP_015897889.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]