SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225874558|ref|YP_002756017.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225874558|ref|YP_002756017.1|
Domain Number 1 Region: 119-435
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.55e-97
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily tRNA-binding arm 7.85e-26
Family Seryl-tRNA synthetase (SerRS) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225874558|ref|YP_002756017.1|
Sequence length 444
Comment seryl-tRNA synthetase [Acidobacterium capsulatum ATCC 51196]
Sequence
MLDLAFVRANLELVEARLRARGQNPAELLGDFAAVDQHRRERITEAEQLKATRNKLSEEV
ARLRKAKEDASAVMEETRQLKTKIEDLERAATEAEEQLRERMARIPNLPYEDVPTGASAE
DNVEVKRWGTPREFDFAPKPHWELGEQLGILDFERAAKLSGARFAVYWAEGARLERALAA
FMLDLHTREHGYTEVLPPLMVNSRSLFGTGQLPKFAEDLFRCEDGEPYQAGKYRENDHWL
IPTAEVPLTNLFRDETLDDSQLSTSLVAHTSCFRSEAGSYGKDVRGIIRQHQFQKVELVK
FTRPEDSAAEHEALTRHAETVLERLGLPYRRMLLCTGDMGFSSAKTYDLEVWLPGQQVYR
EISSCSNFDAFQARRAGIRYRPRGQGKSAHVHTLNGSGLAIGRTWLAILENYQQADGSVR
IPEALIPYMGTEVIESRNVAQGAK
Download sequence
Identical sequences C1F4G5
WP_015898056.1.62785 240015.ACP_3008 gi|225874558|ref|YP_002756017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]