SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225874812|ref|YP_002756271.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|225874812|ref|YP_002756271.1|
Domain Number - Region: 81-128
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00145
Family Terminase gpNU1 subunit domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225874812|ref|YP_002756271.1|
Sequence length 149
Comment MerR family transcriptional regulator [Acidobacterium capsulatum ATCC 51196]
Sequence
MSQTLLIPTLPTETDATLARETSRLLAPRMRSKAPLRVRVVGAAKEETLELPAPAVQMLI
RILEEMARGNAVTLIPVHAELTTQEAADMLNISRPSLIQLLDEGKMEYRKVGTHRRVRFD
ALMAYKRQADADRRAALAELVAYDQEIGI
Download sequence
Identical sequences C1F5T6
WP_015898305.1.62785 gi|225874812|ref|YP_002756271.1| 240015.ACP_3271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]