SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225874877|ref|YP_002756336.1| from Acidobacterium capsulatum ATCC 51196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225874877|ref|YP_002756336.1|
Domain Number 1 Region: 2-378
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.05e-104
Family Homocysteine S-methyltransferase 0.00000509
Further Details:      
 
Domain Number 2 Region: 883-1157
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.57e-93
Family Methionine synthase SAM-binding domain 0.00044
Further Details:      
 
Domain Number 3 Region: 335-597
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 8.77e-71
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00047
Further Details:      
 
Domain Number 4 Region: 720-848
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.75e-38
Family Cobalamin (vitamin B12)-binding domain 0.0000688
Further Details:      
 
Domain Number 5 Region: 651-716
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.2e-17
Family Methionine synthase domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|225874877|ref|YP_002756336.1|
Sequence length 1157
Comment methionine synthase [Acidobacterium capsulatum ATCC 51196]
Sequence
MSDFLEALKQRVLVYDGAMGTNIQKHALTLDDYWGKEGCNELLVLSRPDIIRDIHASFFA
VGCDVVETDSFGSSRIVLAEYDLQDQTRELNIAAAKLAREVADSFSTPDRPRFVAGSIGP
TTKLPSLGHISYDDMALTYREQIEALIEGGVDVLLIETAQDLLQAKIALAACHDAMRATG
RHLPIQMQVTIEATGTMLLGTEIGAALATLECFDPDIIGLNCATGPAEMNDAVRFLCQNA
TRPVSVLPNAGLPQNVGGHAVYALTPEELAKYHRSFVTEYGVQVVGGCCGTTPEHLKAVV
EAVKDAKPAPRHVQPQSVAASAFSALPLEVDGQPVIVAEEMNTTTRVEHFRNMVRAGDYD
GILALAKKLVAEGSQMLDLCCAIVGEDEKAYMCSVLEKIATRVTAPILVDSTEADVIEEG
LKRIPGKPVINSINLEDGEKRTSQVLPMAKRYGAAVIALTIDEDGMALTAEKKVAVARRI
HDLAVNKYGLRPQDLIFDPLTLPISTGQEDYRTAGIETLEAVRRIKQEIPYVKTILGVSN
ISFGLNAYARRVLNSVFLKEAVDRGLDSAIVNYSKIYPLYKIPEREVELARRLVFYDTVE
GDPLQAYMAHFAGTKGKVQDDSEELASLPVDETLKQLIIRGERSVGSGSNKRSLEEVLES
ALTDWKPLDLINDVLLDGMKTVGELFGARKMQLPSVLDSAAVMKAAVAYLEPKMERVEGS
QRGTIVLATVKGDVHDIGKNLVDIILSNNGFKVVNLGIKQPADTIIQAAREHKADAIGLS
GLLVKSTLEMKYVVQDMQRLAMEIPVICGGAALTRKYVEEDLRQEYSQGVFYAEDAFAGL
HVMTDITSEEALREARMSEGRTVKVFPKKPVVEVSAVDAAAPVVRSSWVTENPEVPVPPF
FGVRVKKDYDLDTVFEYINEIALFKNQWQLKTASATDYARLVEEKYRPVLEELKTEVKRE
GWFHPQMVYGFFPAQSEGNDLIVYDAEDPAKERLRITFPRQAEGRKLSIADFFRPKSEGV
YDVVGFSVVTIGHEASEVTKRLFDAGDFTRYLYLHGLSVETAEALAELAHREIRQDLGIA
GEDAPRINDLFHQKYRGSRYSFGYPACPNLEDQTKIFELLEPEKNIGVRLTEGFHLEPEQ
STNALIVHHPQAKYFVV
Download sequence
Identical sequences C1F6A7
240015.ACP_3337 WP_015898370.1.62785 gi|225874877|ref|YP_002756336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]