SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220905805|ref|YP_002481116.1| from Cyanothece sp. PCC 7425

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220905805|ref|YP_002481116.1|
Domain Number 1 Region: 161-259
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000314
Family Anti-sigma factor antagonist SpoIIaa 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220905805|ref|YP_002481116.1|
Sequence length 279
Comment anti-sigma-factor antagonist [Cyanothece sp. PCC 7425]
Sequence
MNLSGMSRLPLILRTYSSDILHDWFRDQMAAGVRTDLINETDLREESREFLESFIQAIQS
GNFYDIHTSEWRGVRNLIAAMTQQREQRGFAPPETALFVLSLKQPLLALLQQEFADDPNT
LLAEFSLLSTLLDKLGLWTMEVYQKSQEEIMLRQQQELLELSTPVVKLGAGILCLPLMGS
LEQTRLQIAMDALLQAIETHRAATVIIDLAGVPNLEAVPAQHLLKTITAVRFMGAECILS
GIRPPVAQAMVYLGMDLGPIVTKATLADALTLAVQRLEN
Download sequence
Identical sequences B8HSV8
395961.Cyan7425_0363 WP_012625857.1.77409 gi|220905805|ref|YP_002481116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]