SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229599738|ref|YP_002860854.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|229599738|ref|YP_002860854.1|
Domain Number - Region: 31-83
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.0432
Family Glutamyl tRNA-reductase dimerization domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229599738|ref|YP_002860854.1|
Sequence length 107
Comment putative transposase [Bacillus anthracis str. A0248]
Sequence
MKNHTRNSKGQLLQTNKKWSHLKQKQRETISNWLREAYIEKIKVHNRRLKPREHEDVLES
VMSKIYDREIWIPDYELEKYYKGKINKWYNKHISLEEKMIGRRTYET
Download sequence
Identical sequences A0A0F7RNA8 A0A171IPK5 Q6EZI5
gi|21392876|ref|NP_652956.1| WP_000788727.1.100214 WP_000788727.1.10208 WP_000788727.1.11427 WP_000788727.1.11676 WP_000788727.1.13115 WP_000788727.1.13820 WP_000788727.1.14855 WP_000788727.1.15460 WP_000788727.1.16170 WP_000788727.1.16997 WP_000788727.1.17146 WP_000788727.1.18976 WP_000788727.1.19258 WP_000788727.1.19435 WP_000788727.1.19445 WP_000788727.1.20390 WP_000788727.1.21021 WP_000788727.1.21776 WP_000788727.1.22865 WP_000788727.1.23269 WP_000788727.1.2419 WP_000788727.1.24334 WP_000788727.1.24608 WP_000788727.1.25716 WP_000788727.1.25752 WP_000788727.1.2618 WP_000788727.1.26721 WP_000788727.1.27644 WP_000788727.1.27987 WP_000788727.1.28427 WP_000788727.1.28729 WP_000788727.1.29101 WP_000788727.1.29787 WP_000788727.1.30110 WP_000788727.1.31490 WP_000788727.1.3236 WP_000788727.1.32576 WP_000788727.1.33175 WP_000788727.1.33338 WP_000788727.1.33740 WP_000788727.1.33876 WP_000788727.1.34646 WP_000788727.1.35684 WP_000788727.1.35886 WP_000788727.1.36305 WP_000788727.1.36763 WP_000788727.1.39781 WP_000788727.1.40550 WP_000788727.1.41165 WP_000788727.1.41675 WP_000788727.1.45305 WP_000788727.1.45533 WP_000788727.1.46236 WP_000788727.1.46699 WP_000788727.1.47145 WP_000788727.1.4763 WP_000788727.1.47644 WP_000788727.1.47798 WP_000788727.1.51749 WP_000788727.1.52794 WP_000788727.1.53137 WP_000788727.1.54117 WP_000788727.1.54189 WP_000788727.1.55811 WP_000788727.1.55958 WP_000788727.1.56042 WP_000788727.1.56176 WP_000788727.1.56270 WP_000788727.1.59095 WP_000788727.1.59310 WP_000788727.1.59575 WP_000788727.1.60402 WP_000788727.1.61213 WP_000788727.1.63560 WP_000788727.1.66378 WP_000788727.1.68607 WP_000788727.1.69203 WP_000788727.1.69822 WP_000788727.1.70065 WP_000788727.1.70996 WP_000788727.1.72704 WP_000788727.1.73325 WP_000788727.1.74226 WP_000788727.1.74538 WP_000788727.1.75870 WP_000788727.1.76125 WP_000788727.1.76783 WP_000788727.1.77668 WP_000788727.1.77824 WP_000788727.1.78644 WP_000788727.1.79315 WP_000788727.1.79584 WP_000788727.1.80439 WP_000788727.1.80695 WP_000788727.1.82289 WP_000788727.1.83951 WP_000788727.1.84045 WP_000788727.1.85689 WP_000788727.1.86119 WP_000788727.1.86140 WP_000788727.1.86239 WP_000788727.1.86288 WP_000788727.1.8698 WP_000788727.1.8825 WP_000788727.1.88641 WP_000788727.1.90791 WP_000788727.1.9186 WP_000788727.1.92686 WP_000788727.1.92831 WP_000788727.1.93271 WP_000788727.1.93744 WP_000788727.1.93927 WP_000788727.1.94237 WP_000788727.1.94322 WP_000788727.1.96934 WP_000788727.1.97781 WP_000788727.1.98216 WP_000788727.1.99485 WP_000788727.1.99994 261594.GBAA_pXO1_0203 568206.BAMEG_A0195 592021.BAA_A0207 gi|21392876|ref|NP_652956.1|NC_003980 gi|227811620|ref|YP_002811631.1|NC_012579 gi|229599738|ref|YP_002860854.1|NC_012656 gi|386733748|ref|YP_006204134.1|NC_017726 gi|446711381|ref|WP_000788727.1|NZ_ABLB01000067 gi|47566512|ref|YP_022464.1|NC_007322 gi|386733748|ref|YP_006204134.1| gi|227811620|ref|YP_002811631.1| gi|229599738|ref|YP_002860854.1| gi|47566512|ref|YP_022464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]