SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229600346|ref|YP_002869173.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229600346|ref|YP_002869173.1|
Domain Number 1 Region: 6-158
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.75e-23
Family Multidrug-binding domain of transcription activator BmrR 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229600346|ref|YP_002869173.1|
Sequence length 159
Comment hypothetical protein BAA_5199 [Bacillus anthracis str. A0248]
Sequence
MINEPIIVKKEAFQAIGISITTTNEKEASTEGKIPGLWNRYFQEQIMHHIPNQQTKETFA
FYSNYESDETGTYTFTIGMPVSSLEDVPETMTTLIIPAATYAVFTTRKGPVAEVVCEAWE
YIWKWSKENKRAFTIDFELYDERALDPTNVQLDIYIALA
Download sequence
Identical sequences A0A0F7RBN3 Q81XR9
NP_847347.1.87267 WP_000606652.1.100214 WP_000606652.1.100595 WP_000606652.1.10208 WP_000606652.1.11427 WP_000606652.1.11676 WP_000606652.1.13115 WP_000606652.1.13233 WP_000606652.1.13820 WP_000606652.1.14721 WP_000606652.1.14855 WP_000606652.1.15460 WP_000606652.1.15569 WP_000606652.1.16170 WP_000606652.1.16997 WP_000606652.1.17146 WP_000606652.1.18976 WP_000606652.1.19258 WP_000606652.1.19435 WP_000606652.1.19445 WP_000606652.1.20390 WP_000606652.1.20680 WP_000606652.1.21021 WP_000606652.1.21258 WP_000606652.1.21776 WP_000606652.1.22865 WP_000606652.1.23269 WP_000606652.1.2419 WP_000606652.1.24334 WP_000606652.1.24556 WP_000606652.1.24608 WP_000606652.1.25716 WP_000606652.1.25752 WP_000606652.1.2618 WP_000606652.1.26665 WP_000606652.1.26721 WP_000606652.1.27644 WP_000606652.1.27987 WP_000606652.1.28427 WP_000606652.1.28729 WP_000606652.1.29101 WP_000606652.1.29787 WP_000606652.1.30110 WP_000606652.1.31490 WP_000606652.1.3236 WP_000606652.1.32576 WP_000606652.1.33175 WP_000606652.1.33338 WP_000606652.1.33367 WP_000606652.1.33740 WP_000606652.1.33876 WP_000606652.1.34646 WP_000606652.1.35684 WP_000606652.1.35886 WP_000606652.1.36305 WP_000606652.1.36763 WP_000606652.1.38036 WP_000606652.1.39781 WP_000606652.1.40550 WP_000606652.1.41165 WP_000606652.1.41675 WP_000606652.1.4439 WP_000606652.1.45305 WP_000606652.1.45533 WP_000606652.1.46236 WP_000606652.1.46699 WP_000606652.1.47145 WP_000606652.1.47644 WP_000606652.1.47798 WP_000606652.1.51749 WP_000606652.1.52794 WP_000606652.1.53137 WP_000606652.1.53493 WP_000606652.1.53683 WP_000606652.1.54117 WP_000606652.1.54189 WP_000606652.1.55811 WP_000606652.1.55958 WP_000606652.1.56042 WP_000606652.1.56176 WP_000606652.1.56270 WP_000606652.1.56959 WP_000606652.1.58160 WP_000606652.1.59095 WP_000606652.1.59310 WP_000606652.1.59575 WP_000606652.1.60402 WP_000606652.1.61213 WP_000606652.1.63560 WP_000606652.1.68607 WP_000606652.1.69203 WP_000606652.1.69822 WP_000606652.1.69894 WP_000606652.1.70065 WP_000606652.1.70996 WP_000606652.1.72704 WP_000606652.1.73325 WP_000606652.1.74226 WP_000606652.1.74538 WP_000606652.1.75499 WP_000606652.1.75870 WP_000606652.1.76125 WP_000606652.1.76783 WP_000606652.1.77668 WP_000606652.1.77824 WP_000606652.1.78644 WP_000606652.1.79315 WP_000606652.1.79584 WP_000606652.1.80439 WP_000606652.1.80695 WP_000606652.1.81799 WP_000606652.1.82289 WP_000606652.1.83951 WP_000606652.1.84045 WP_000606652.1.85689 WP_000606652.1.86119 WP_000606652.1.86140 WP_000606652.1.86239 WP_000606652.1.86288 WP_000606652.1.8698 WP_000606652.1.8825 WP_000606652.1.88641 WP_000606652.1.90791 WP_000606652.1.90883 WP_000606652.1.9186 WP_000606652.1.92686 WP_000606652.1.92831 WP_000606652.1.93271 WP_000606652.1.93744 WP_000606652.1.93927 WP_000606652.1.94237 WP_000606652.1.94322 WP_000606652.1.94784 WP_000606652.1.96934 WP_000606652.1.97781 WP_000606652.1.97861 WP_000606652.1.98216 WP_000606652.1.99445 WP_000606652.1.99485 WP_000606652.1.99994 YP_031042.1.16718 gi|229600346|ref|YP_002869173.1| gi|386738801|ref|YP_006211982.1| gi|30264970|ref|NP_847347.1| gi|49187789|ref|YP_031042.1| gi|227817700|ref|YP_002817709.1| 198094.BA_5162 260799.BAS4799 261594.GBAA5162 568206.BAMEG_5220 592021.BAA_5199 gi|47530468|ref|YP_021817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]