SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229601660|ref|YP_002867016.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229601660|ref|YP_002867016.1|
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 8.37e-28
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229601660|ref|YP_002867016.1|
Sequence length 159
Comment hypothetical protein BAA_2797 [Bacillus anthracis str. A0248]
Sequence
MKVIIKNLPSLEVAFIRRTGSYFEPQDHWGKLLNWSIENKLYPLEQSFIGISLDNPELVA
SHMCRHDACVTIPKNFEKEQHEDVQFKSVDGGLYALYQFYDEPHKLSEVYRYMYAVWLPN
SEYSADYDRDNLEFCMNNVAEDLEGKLKVDLFVPIKKNK
Download sequence
Identical sequences A0A0B5NU09 A0A1N7UA04 A0A1Q4LZ68 A0A242VXG5 A0A243D1X0 Q81PR8
gi|47528024|ref|YP_019373.1| gi|227814454|ref|YP_002814463.1| gi|229601660|ref|YP_002867016.1| gi|49185554|ref|YP_028806.1| NP_845083.1.87267 WP_000864414.1.100059 WP_000864414.1.100214 WP_000864414.1.100409 WP_000864414.1.100595 WP_000864414.1.10208 WP_000864414.1.11427 WP_000864414.1.11676 WP_000864414.1.13115 WP_000864414.1.13233 WP_000864414.1.13820 WP_000864414.1.14721 WP_000864414.1.14855 WP_000864414.1.15460 WP_000864414.1.15569 WP_000864414.1.16013 WP_000864414.1.16170 WP_000864414.1.16997 WP_000864414.1.17146 WP_000864414.1.18976 WP_000864414.1.19258 WP_000864414.1.19435 WP_000864414.1.19445 WP_000864414.1.20390 WP_000864414.1.20680 WP_000864414.1.21021 WP_000864414.1.21258 WP_000864414.1.21776 WP_000864414.1.22865 WP_000864414.1.23269 WP_000864414.1.23615 WP_000864414.1.2419 WP_000864414.1.24334 WP_000864414.1.24556 WP_000864414.1.24608 WP_000864414.1.25716 WP_000864414.1.25752 WP_000864414.1.2618 WP_000864414.1.26665 WP_000864414.1.26721 WP_000864414.1.27644 WP_000864414.1.27987 WP_000864414.1.28427 WP_000864414.1.28729 WP_000864414.1.29101 WP_000864414.1.29787 WP_000864414.1.29804 WP_000864414.1.30110 WP_000864414.1.31490 WP_000864414.1.3236 WP_000864414.1.32576 WP_000864414.1.33175 WP_000864414.1.33338 WP_000864414.1.33367 WP_000864414.1.33740 WP_000864414.1.33876 WP_000864414.1.34646 WP_000864414.1.35684 WP_000864414.1.35886 WP_000864414.1.36305 WP_000864414.1.36763 WP_000864414.1.38036 WP_000864414.1.39781 WP_000864414.1.40550 WP_000864414.1.41165 WP_000864414.1.41365 WP_000864414.1.41675 WP_000864414.1.42217 WP_000864414.1.4439 WP_000864414.1.45305 WP_000864414.1.45533 WP_000864414.1.45919 WP_000864414.1.46236 WP_000864414.1.46699 WP_000864414.1.4763 WP_000864414.1.47644 WP_000864414.1.47798 WP_000864414.1.51749 WP_000864414.1.52794 WP_000864414.1.53137 WP_000864414.1.53493 WP_000864414.1.53683 WP_000864414.1.54117 WP_000864414.1.54189 WP_000864414.1.55811 WP_000864414.1.55958 WP_000864414.1.55968 WP_000864414.1.56042 WP_000864414.1.56176 WP_000864414.1.56270 WP_000864414.1.56959 WP_000864414.1.58160 WP_000864414.1.59095 WP_000864414.1.59310 WP_000864414.1.59575 WP_000864414.1.59978 WP_000864414.1.60402 WP_000864414.1.61213 WP_000864414.1.63137 WP_000864414.1.63560 WP_000864414.1.63611 WP_000864414.1.67239 WP_000864414.1.68607 WP_000864414.1.69203 WP_000864414.1.69822 WP_000864414.1.69894 WP_000864414.1.70065 WP_000864414.1.70996 WP_000864414.1.72704 WP_000864414.1.73325 WP_000864414.1.74226 WP_000864414.1.74538 WP_000864414.1.75499 WP_000864414.1.75870 WP_000864414.1.76125 WP_000864414.1.76783 WP_000864414.1.77668 WP_000864414.1.77824 WP_000864414.1.78644 WP_000864414.1.79315 WP_000864414.1.79584 WP_000864414.1.80439 WP_000864414.1.80695 WP_000864414.1.81799 WP_000864414.1.82289 WP_000864414.1.83951 WP_000864414.1.84045 WP_000864414.1.85689 WP_000864414.1.85901 WP_000864414.1.86119 WP_000864414.1.86140 WP_000864414.1.86239 WP_000864414.1.86288 WP_000864414.1.8698 WP_000864414.1.8825 WP_000864414.1.88641 WP_000864414.1.90791 WP_000864414.1.90883 WP_000864414.1.9186 WP_000864414.1.92686 WP_000864414.1.92831 WP_000864414.1.93271 WP_000864414.1.93744 WP_000864414.1.93927 WP_000864414.1.94237 WP_000864414.1.94322 WP_000864414.1.94784 WP_000864414.1.96934 WP_000864414.1.97781 WP_000864414.1.97861 WP_000864414.1.98216 WP_000864414.1.99445 WP_000864414.1.99485 WP_000864414.1.99994 YP_028806.1.16718 198094.BA_2733 260799.BAS2546 261594.GBAA2733 568206.BAMEG_1862 592021.BAA_2797 gi|30262706|ref|NP_845083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]