SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229601958|ref|YP_002864719.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229601958|ref|YP_002864719.1|
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily Hsp33 domain 3.66e-79
Family Hsp33 domain 0.0000000692
Further Details:      
 
Domain Number 2 Region: 232-290
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.14e-19
Family HSP33 redox switch-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229601958|ref|YP_002864719.1|
Sequence length 291
Comment Hsp33-like chaperonin [Bacillus anthracis str. A0248]
Sequence
MKDYLVKALAFDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGRSLTAGTMMGAMLKGD
QKLTIKVEGNGPIGPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGTEGFVTVI
KDIGMREPFIGQSPIVSGELGEDFTYYFAVSEQTPSSVGVGVLVNGDDSILAAGGFILQI
MPGAQEETISFIEERLQKIPPVSTLIEQGLSPEELLYAVLGEDKVKVLETMDVQFNCTCS
RERIESVLISLGKTELEQVREEEEETEVHCHFCNERYKFSKEDITNLIENL
Download sequence
Identical sequences A0A063CBQ0 A0A0B5NGA9 A0A0F5RJH5 A0A0K6MJ37 A0A0T8W4K2 A0A1J9TLC9 A0A1J9VSB4 A0A1J9XTQ0 A0A1J9Z5P7 A0A1S9A9P8 A0A229M539 A0A242W3A8 A0A242YME9 A0A243BJZ3 A0A243C4F2 A0A243GVU5 A0A243I8L6 A0A246UKN0 A0A2C9ZFV3 A0A2K1RUH5 A0R8D9 B3ZF75 B3ZW00 B7HPX8 B7JK74 B9IZF0 C1ESZ7 C2MER6 C2NBK9 C2QLZ3 C2RXJ8 C2TA93 C2VML6 C3BW91 C3FX01 C3GCU1 C3LJ40 C3P9L3 D8GWL5 F0PQ13 J8HC18 J8J579 Q63HD2 Q6HPV0 Q73FE1 Q81VX3
gi|386733935|ref|YP_006207116.1| gi|52145150|ref|YP_081679.1| gi|375282164|ref|YP_005102597.1| gi|49479980|ref|YP_034420.1| gi|222093837|ref|YP_002527886.1| gi|30260258|ref|NP_842635.1| NP_842635.1.87267 WP_000656366.1.100059 WP_000656366.1.100214 WP_000656366.1.100241 WP_000656366.1.100684 WP_000656366.1.10069 WP_000656366.1.100873 WP_000656366.1.101309 WP_000656366.1.101550 WP_000656366.1.101843 WP_000656366.1.101931 WP_000656366.1.10208 WP_000656366.1.10762 WP_000656366.1.11044 WP_000656366.1.11060 WP_000656366.1.11387 WP_000656366.1.11427 WP_000656366.1.11676 WP_000656366.1.1228 WP_000656366.1.12751 WP_000656366.1.13024 WP_000656366.1.13115 WP_000656366.1.13233 WP_000656366.1.13820 WP_000656366.1.14721 WP_000656366.1.14855 WP_000656366.1.14882 WP_000656366.1.15163 WP_000656366.1.15460 WP_000656366.1.15569 WP_000656366.1.16013 WP_000656366.1.16156 WP_000656366.1.16170 WP_000656366.1.16199 WP_000656366.1.16997 WP_000656366.1.17146 WP_000656366.1.17408 WP_000656366.1.17424 WP_000656366.1.17899 WP_000656366.1.17927 WP_000656366.1.1850 WP_000656366.1.18840 WP_000656366.1.18976 WP_000656366.1.19173 WP_000656366.1.19258 WP_000656366.1.19435 WP_000656366.1.19445 WP_000656366.1.195 WP_000656366.1.20390 WP_000656366.1.20665 WP_000656366.1.20680 WP_000656366.1.20687 WP_000656366.1.20865 WP_000656366.1.20973 WP_000656366.1.21021 WP_000656366.1.21172 WP_000656366.1.21258 WP_000656366.1.21776 WP_000656366.1.226 WP_000656366.1.22865 WP_000656366.1.23110 WP_000656366.1.23200 WP_000656366.1.23269 WP_000656366.1.23615 WP_000656366.1.24182 WP_000656366.1.24184 WP_000656366.1.2419 WP_000656366.1.24334 WP_000656366.1.24377 WP_000656366.1.24556 WP_000656366.1.24608 WP_000656366.1.24676 WP_000656366.1.24709 WP_000656366.1.24759 WP_000656366.1.2521 WP_000656366.1.25316 WP_000656366.1.25505 WP_000656366.1.2569 WP_000656366.1.25716 WP_000656366.1.25752 WP_000656366.1.25757 WP_000656366.1.26000 WP_000656366.1.2618 WP_000656366.1.26499 WP_000656366.1.26665 WP_000656366.1.26721 WP_000656366.1.27334 WP_000656366.1.27644 WP_000656366.1.27987 WP_000656366.1.28427 WP_000656366.1.28729 WP_000656366.1.28913 WP_000656366.1.29101 WP_000656366.1.29209 WP_000656366.1.29451 WP_000656366.1.29787 WP_000656366.1.29804 WP_000656366.1.30091 WP_000656366.1.30216 WP_000656366.1.3026 WP_000656366.1.30317 WP_000656366.1.30336 WP_000656366.1.31490 WP_000656366.1.31503 WP_000656366.1.31685 WP_000656366.1.3236 WP_000656366.1.32522 WP_000656366.1.32576 WP_000656366.1.33045 WP_000656366.1.33061 WP_000656366.1.33175 WP_000656366.1.3318 WP_000656366.1.33338 WP_000656366.1.33367 WP_000656366.1.33536 WP_000656366.1.33740 WP_000656366.1.33828 WP_000656366.1.33876 WP_000656366.1.34158 WP_000656366.1.34646 WP_000656366.1.35255 WP_000656366.1.35518 WP_000656366.1.3561 WP_000656366.1.35684 WP_000656366.1.35886 WP_000656366.1.3615 WP_000656366.1.36305 WP_000656366.1.36763 WP_000656366.1.3699 WP_000656366.1.37093 WP_000656366.1.37626 WP_000656366.1.37990 WP_000656366.1.38036 WP_000656366.1.38425 WP_000656366.1.38517 WP_000656366.1.39001 WP_000656366.1.39781 WP_000656366.1.40550 WP_000656366.1.40839 WP_000656366.1.41165 WP_000656366.1.41365 WP_000656366.1.41675 WP_000656366.1.41976 WP_000656366.1.42165 WP_000656366.1.42217 WP_000656366.1.43104 WP_000656366.1.43533 WP_000656366.1.43762 WP_000656366.1.4439 WP_000656366.1.44463 WP_000656366.1.44483 WP_000656366.1.45089 WP_000656366.1.45305 WP_000656366.1.45385 WP_000656366.1.45533 WP_000656366.1.45919 WP_000656366.1.46236 WP_000656366.1.46244 WP_000656366.1.46476 WP_000656366.1.46549 WP_000656366.1.46699 WP_000656366.1.46864 WP_000656366.1.47097 WP_000656366.1.47145 WP_000656366.1.47441 WP_000656366.1.4763 WP_000656366.1.47644 WP_000656366.1.47798 WP_000656366.1.47936 WP_000656366.1.48010 WP_000656366.1.48164 WP_000656366.1.48311 WP_000656366.1.48599 WP_000656366.1.49428 WP_000656366.1.49802 WP_000656366.1.49831 WP_000656366.1.50316 WP_000656366.1.50514 WP_000656366.1.50770 WP_000656366.1.51087 WP_000656366.1.51167 WP_000656366.1.51335 WP_000656366.1.51656 WP_000656366.1.51749 WP_000656366.1.52494 WP_000656366.1.52756 WP_000656366.1.52794 WP_000656366.1.53137 WP_000656366.1.53493 WP_000656366.1.53621 WP_000656366.1.53683 WP_000656366.1.53879 WP_000656366.1.54117 WP_000656366.1.54189 WP_000656366.1.54775 WP_000656366.1.54782 WP_000656366.1.55057 WP_000656366.1.55811 WP_000656366.1.55958 WP_000656366.1.55968 WP_000656366.1.56042 WP_000656366.1.56055 WP_000656366.1.56176 WP_000656366.1.56270 WP_000656366.1.5628 WP_000656366.1.56318 WP_000656366.1.56580 WP_000656366.1.56959 WP_000656366.1.57203 WP_000656366.1.57245 WP_000656366.1.57565 WP_000656366.1.57815 WP_000656366.1.57859 WP_000656366.1.58037 WP_000656366.1.58160 WP_000656366.1.58328 WP_000656366.1.58814 WP_000656366.1.59052 WP_000656366.1.59095 WP_000656366.1.59173 WP_000656366.1.59310 WP_000656366.1.59773 WP_000656366.1.59978 WP_000656366.1.60274 WP_000656366.1.60402 WP_000656366.1.60781 WP_000656366.1.61213 WP_000656366.1.61231 WP_000656366.1.61944 WP_000656366.1.62107 WP_000656366.1.63137 WP_000656366.1.6340 WP_000656366.1.63560 WP_000656366.1.64377 WP_000656366.1.64491 WP_000656366.1.64706 WP_000656366.1.65758 WP_000656366.1.65983 WP_000656366.1.66331 WP_000656366.1.66357 WP_000656366.1.67108 WP_000656366.1.67239 WP_000656366.1.6753 WP_000656366.1.68607 WP_000656366.1.69203 WP_000656366.1.69323 WP_000656366.1.69822 WP_000656366.1.69894 WP_000656366.1.69970 WP_000656366.1.70065 WP_000656366.1.70645 WP_000656366.1.7096 WP_000656366.1.70996 WP_000656366.1.71441 WP_000656366.1.71648 WP_000656366.1.71895 WP_000656366.1.71953 WP_000656366.1.72514 WP_000656366.1.72704 WP_000656366.1.73325 WP_000656366.1.7398 WP_000656366.1.74226 WP_000656366.1.74337 WP_000656366.1.74538 WP_000656366.1.7545 WP_000656366.1.75499 WP_000656366.1.75870 WP_000656366.1.76125 WP_000656366.1.7628 WP_000656366.1.76783 WP_000656366.1.77370 WP_000656366.1.77576 WP_000656366.1.77668 WP_000656366.1.77690 WP_000656366.1.77824 WP_000656366.1.77902 WP_000656366.1.7856 WP_000656366.1.78644 WP_000656366.1.79043 WP_000656366.1.79250 WP_000656366.1.79252 WP_000656366.1.79315 WP_000656366.1.79584 WP_000656366.1.79658 WP_000656366.1.80239 WP_000656366.1.80439 WP_000656366.1.80695 WP_000656366.1.80955 WP_000656366.1.80964 WP_000656366.1.81088 WP_000656366.1.81799 WP_000656366.1.82289 WP_000656366.1.82421 WP_000656366.1.82533 WP_000656366.1.82986 WP_000656366.1.83070 WP_000656366.1.83951 WP_000656366.1.84045 WP_000656366.1.84337 WP_000656366.1.84422 WP_000656366.1.8450 WP_000656366.1.85689 WP_000656366.1.85901 WP_000656366.1.86082 WP_000656366.1.86119 WP_000656366.1.86140 WP_000656366.1.86239 WP_000656366.1.86288 WP_000656366.1.8698 WP_000656366.1.87627 WP_000656366.1.8825 WP_000656366.1.88431 WP_000656366.1.88641 WP_000656366.1.8923 WP_000656366.1.89675 WP_000656366.1.90155 WP_000656366.1.90596 WP_000656366.1.90671 WP_000656366.1.90791 WP_000656366.1.90883 WP_000656366.1.91404 WP_000656366.1.91569 WP_000656366.1.91615 WP_000656366.1.9186 WP_000656366.1.92347 WP_000656366.1.92686 WP_000656366.1.9269 WP_000656366.1.92831 WP_000656366.1.93271 WP_000656366.1.93744 WP_000656366.1.93893 WP_000656366.1.93927 WP_000656366.1.93932 WP_000656366.1.94237 WP_000656366.1.94322 WP_000656366.1.94373 WP_000656366.1.94784 WP_000656366.1.95308 WP_000656366.1.95457 WP_000656366.1.95484 WP_000656366.1.95786 WP_000656366.1.96356 WP_000656366.1.96934 WP_000656366.1.97149 WP_000656366.1.97617 WP_000656366.1.97781 WP_000656366.1.98216 WP_000656366.1.98557 WP_000656366.1.98571 WP_000656366.1.99266 WP_000656366.1.99454 WP_000656366.1.99485 WP_000656366.1.99994 YP_026353.1.16718 YP_034420.1.62562 gi|118475838|ref|YP_892989.1| gi|42779146|ref|NP_976393.1| gi|217957643|ref|YP_002336185.1| gi|301051805|ref|YP_003790016.1| gi|227812741|ref|YP_002812750.1| gi|218901269|ref|YP_002449103.1| gi|225862120|ref|YP_002747498.1| gi|384177973|ref|YP_005563735.1| gi|47525320|ref|YP_016669.1| gi|229601958|ref|YP_002864719.1| 198094.BA_0066 222523.BCE_0065 260799.BAS0066 261594.GBAA0066 281309.BT9727_0062 288681.BCZK0062 361100.BCQ_0076 405534.BCAH187_A0078 405535.BCAH820_0075 412694.BALH_0065 568206.BAMEG_0079 572264.BCA_0079 592021.BAA_0079 gi|49183101|ref|YP_026353.1| gi|376264095|ref|YP_005116807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]