SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229602212|ref|YP_002869104.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229602212|ref|YP_002869104.1|
Domain Number 1 Region: 130-292
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.05e-31
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.086
Further Details:      
 
Domain Number 2 Region: 59-114
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000851
Family AraC type transcriptional activator 0.0087
Further Details:      
 
Domain Number 3 Region: 8-57
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000112
Family AraC type transcriptional activator 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229602212|ref|YP_002869104.1|
Sequence length 292
Comment AraC family transcriptional regulator [Bacillus anthracis str. A0248]
Sequence
MVMDSLKNMNAAMQYIEENLTHEIDFKEVAKIAYCSEYHFKRMFSFLAGISLSEYIRCRR
LTLAAFELKNSDAKVIDVAIKYGYNSPDSFSRAFQNLHGITPSEARSSSHSLKAYSPMTF
QLSIQGGHEMNYRIEEKEPFQIIGITKRVPIVFNGVNEEIASMWKSLNPEAIQTLKSLSN
MEPTGIISASTNFSEGRMEEKGELDHYIGVATTKDCPEQFAQLEVAASTWAIFEAVGPFP
ETLQNVWGRIYSEWFPSSNYELAEGPEILWNEQKDISSPNFKSEIWIPVLKK
Download sequence
Identical sequences A0A0F7RAJ8
gi|229602212|ref|YP_002869104.1| gi|386738729|ref|YP_006211910.1| 592021.BAA_5097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]