SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229604371|ref|YP_002867283.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229604371|ref|YP_002867283.1|
Domain Number 1 Region: 137-295
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.4e-36
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0017
Further Details:      
 
Domain Number 2 Region: 65-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000672
Family AraC type transcriptional activator 0.01
Further Details:      
 
Domain Number 3 Region: 12-62
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000466
Family AraC type transcriptional activator 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229604371|ref|YP_002867283.1|
Sequence length 296
Comment AraC family transcriptional regulator [Bacillus anthracis str. A0248]
Sequence
MENKQSRNEYLQRIYKVQNYIELHINDSLSIEELADIAGFSKYHFHRIFKGIVDEPLSRY
VNRLKLERATNLLTYRSDMTITDITYHFGFTDSAVFSRTFKNYYGVSPSQYRNDNSKNCK
DVRRISQYNECKKVRRNVEIVTVDNINVAYIRHIGTYEELTIAFPKMIEKLFQYATKQNY
HVFEDTKVLTIYHDHHEFTEDNHLRTSLCITIPGESAIETNDIGIMVIPSGKYAVGHFEI
FQDEYKRAWDFIYGEWLPNSGYKPRDSYPFEVYRNDPKQHPKHKHIVDIYVPIEPF
Download sequence
Identical sequences A0A0F7RFY2 Q81NW5
gi|49185849|ref|YP_029101.1| NP_845387.1.87267 WP_000428659.1.100214 WP_000428659.1.100595 WP_000428659.1.10208 WP_000428659.1.11676 WP_000428659.1.13115 WP_000428659.1.13233 WP_000428659.1.13820 WP_000428659.1.14721 WP_000428659.1.14855 WP_000428659.1.15460 WP_000428659.1.15569 WP_000428659.1.16170 WP_000428659.1.16997 WP_000428659.1.17146 WP_000428659.1.18976 WP_000428659.1.19258 WP_000428659.1.19435 WP_000428659.1.20390 WP_000428659.1.20680 WP_000428659.1.21021 WP_000428659.1.21258 WP_000428659.1.21776 WP_000428659.1.22865 WP_000428659.1.2419 WP_000428659.1.24334 WP_000428659.1.24556 WP_000428659.1.24608 WP_000428659.1.25716 WP_000428659.1.25752 WP_000428659.1.2618 WP_000428659.1.26665 WP_000428659.1.26721 WP_000428659.1.27644 WP_000428659.1.27987 WP_000428659.1.28427 WP_000428659.1.28729 WP_000428659.1.29101 WP_000428659.1.29787 WP_000428659.1.30110 WP_000428659.1.3236 WP_000428659.1.32576 WP_000428659.1.33338 WP_000428659.1.33367 WP_000428659.1.33740 WP_000428659.1.33876 WP_000428659.1.34646 WP_000428659.1.35684 WP_000428659.1.35886 WP_000428659.1.36305 WP_000428659.1.36763 WP_000428659.1.38036 WP_000428659.1.39781 WP_000428659.1.40550 WP_000428659.1.41165 WP_000428659.1.41675 WP_000428659.1.4439 WP_000428659.1.45305 WP_000428659.1.45533 WP_000428659.1.46236 WP_000428659.1.46699 WP_000428659.1.47145 WP_000428659.1.4763 WP_000428659.1.47798 WP_000428659.1.52794 WP_000428659.1.53137 WP_000428659.1.53493 WP_000428659.1.53683 WP_000428659.1.54117 WP_000428659.1.54189 WP_000428659.1.55811 WP_000428659.1.55958 WP_000428659.1.56042 WP_000428659.1.56176 WP_000428659.1.56270 WP_000428659.1.56959 WP_000428659.1.58160 WP_000428659.1.59095 WP_000428659.1.59310 WP_000428659.1.59575 WP_000428659.1.60402 WP_000428659.1.61213 WP_000428659.1.63560 WP_000428659.1.68607 WP_000428659.1.69203 WP_000428659.1.69822 WP_000428659.1.69894 WP_000428659.1.70065 WP_000428659.1.72704 WP_000428659.1.73325 WP_000428659.1.74226 WP_000428659.1.74538 WP_000428659.1.75499 WP_000428659.1.75870 WP_000428659.1.76125 WP_000428659.1.76783 WP_000428659.1.77668 WP_000428659.1.77824 WP_000428659.1.78644 WP_000428659.1.79315 WP_000428659.1.79584 WP_000428659.1.80439 WP_000428659.1.80695 WP_000428659.1.81799 WP_000428659.1.82289 WP_000428659.1.83951 WP_000428659.1.84045 WP_000428659.1.85689 WP_000428659.1.86119 WP_000428659.1.86140 WP_000428659.1.86288 WP_000428659.1.8698 WP_000428659.1.8825 WP_000428659.1.88641 WP_000428659.1.90791 WP_000428659.1.90883 WP_000428659.1.9186 WP_000428659.1.92686 WP_000428659.1.92831 WP_000428659.1.93271 WP_000428659.1.93927 WP_000428659.1.94237 WP_000428659.1.94322 WP_000428659.1.94784 WP_000428659.1.96934 WP_000428659.1.97781 WP_000428659.1.97861 WP_000428659.1.98216 WP_000428659.1.99445 WP_000428659.1.99485 YP_029101.1.16718 gi|30263010|ref|NP_845387.1| gi|227814143|ref|YP_002814152.1| 198094.BA_3057 260799.BAS2843 261594.GBAA3057 568206.BAMEG_1551 592021.BAA_3107 gi|229604371|ref|YP_002867283.1| gi|386736790|ref|YP_006209971.1| gi|47528349|ref|YP_019698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]