SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229604847|ref|YP_002868750.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229604847|ref|YP_002868750.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 3.01e-45
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00062
Further Details:      
 
Domain Number 2 Region: 163-314
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.2e-33
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00074
Further Details:      
 
Domain Number 3 Region: 317-420
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 5.1e-17
Family Glutamyl tRNA-reductase dimerization domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229604847|ref|YP_002868750.1|
Sequence length 444
Comment glutamyl-tRNA reductase [Bacillus anthracis str. A0248]
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVD
QLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQ
IKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGEL
TDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCAL
LEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDI
DDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETM
ESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLE
MEDVESRAEEVEHKRVWTPSVPSL
Download sequence
Identical sequences A0A0B5NLA7 A0A0G8DM83 A0A0K6MKL0 A0A0U0DT44 A0A154AX87 A0A1S0QW50 A0A242W7L3 A0A243AUZ6 A0A243CN29 A0RJ83 B3ZNQ2 B7JQ59 C2NNG1 C2TML2 C2VZJ9 C3G8S1 C3GPK5 C3L6Z7 C3P9F1 Q6HD60 Q81LC5
gi|218905668|ref|YP_002453502.1| gi|49478647|ref|YP_038516.1| gi|229604847|ref|YP_002868750.1| gi|30264534|ref|NP_846911.1| IDP02777 gi|47529997|ref|YP_021346.1| NP_846911.1.87267 WP_000547860.1.100059 WP_000547860.1.100214 WP_000547860.1.100409 WP_000547860.1.100595 WP_000547860.1.101931 WP_000547860.1.10208 WP_000547860.1.11387 WP_000547860.1.11427 WP_000547860.1.11676 WP_000547860.1.12289 WP_000547860.1.13115 WP_000547860.1.13221 WP_000547860.1.13233 WP_000547860.1.13820 WP_000547860.1.14721 WP_000547860.1.14855 WP_000547860.1.14882 WP_000547860.1.15163 WP_000547860.1.15460 WP_000547860.1.15569 WP_000547860.1.16013 WP_000547860.1.16156 WP_000547860.1.16170 WP_000547860.1.16997 WP_000547860.1.17146 WP_000547860.1.18976 WP_000547860.1.19258 WP_000547860.1.19435 WP_000547860.1.19445 WP_000547860.1.20390 WP_000547860.1.20665 WP_000547860.1.20680 WP_000547860.1.20865 WP_000547860.1.21021 WP_000547860.1.21258 WP_000547860.1.21776 WP_000547860.1.22865 WP_000547860.1.23269 WP_000547860.1.23615 WP_000547860.1.23873 WP_000547860.1.2419 WP_000547860.1.24334 WP_000547860.1.24556 WP_000547860.1.24608 WP_000547860.1.24676 WP_000547860.1.25716 WP_000547860.1.25752 WP_000547860.1.26000 WP_000547860.1.2618 WP_000547860.1.26665 WP_000547860.1.26721 WP_000547860.1.27644 WP_000547860.1.27987 WP_000547860.1.28427 WP_000547860.1.28729 WP_000547860.1.29101 WP_000547860.1.29787 WP_000547860.1.29804 WP_000547860.1.30110 WP_000547860.1.30216 WP_000547860.1.31490 WP_000547860.1.3236 WP_000547860.1.32576 WP_000547860.1.33175 WP_000547860.1.33338 WP_000547860.1.33367 WP_000547860.1.33536 WP_000547860.1.33740 WP_000547860.1.33828 WP_000547860.1.33876 WP_000547860.1.34158 WP_000547860.1.34646 WP_000547860.1.35684 WP_000547860.1.35886 WP_000547860.1.36305 WP_000547860.1.36763 WP_000547860.1.3699 WP_000547860.1.38036 WP_000547860.1.39781 WP_000547860.1.40550 WP_000547860.1.41165 WP_000547860.1.41365 WP_000547860.1.41675 WP_000547860.1.42217 WP_000547860.1.43104 WP_000547860.1.4439 WP_000547860.1.45305 WP_000547860.1.45385 WP_000547860.1.45533 WP_000547860.1.45919 WP_000547860.1.46236 WP_000547860.1.46476 WP_000547860.1.4649 WP_000547860.1.46549 WP_000547860.1.46699 WP_000547860.1.47145 WP_000547860.1.4763 WP_000547860.1.47644 WP_000547860.1.47798 WP_000547860.1.4865 WP_000547860.1.49831 WP_000547860.1.51167 WP_000547860.1.51749 WP_000547860.1.52794 WP_000547860.1.53137 WP_000547860.1.53493 WP_000547860.1.53683 WP_000547860.1.53879 WP_000547860.1.54117 WP_000547860.1.54189 WP_000547860.1.55811 WP_000547860.1.55958 WP_000547860.1.55968 WP_000547860.1.56042 WP_000547860.1.56176 WP_000547860.1.56270 WP_000547860.1.56318 WP_000547860.1.56580 WP_000547860.1.56959 WP_000547860.1.58160 WP_000547860.1.59095 WP_000547860.1.59173 WP_000547860.1.59310 WP_000547860.1.59575 WP_000547860.1.59978 WP_000547860.1.60402 WP_000547860.1.60841 WP_000547860.1.61213 WP_000547860.1.63137 WP_000547860.1.63560 WP_000547860.1.63611 WP_000547860.1.64491 WP_000547860.1.66331 WP_000547860.1.66357 WP_000547860.1.67239 WP_000547860.1.68607 WP_000547860.1.69203 WP_000547860.1.69323 WP_000547860.1.69822 WP_000547860.1.69894 WP_000547860.1.70065 WP_000547860.1.7096 WP_000547860.1.70996 WP_000547860.1.72704 WP_000547860.1.73325 WP_000547860.1.74226 WP_000547860.1.74538 WP_000547860.1.7545 WP_000547860.1.75499 WP_000547860.1.75870 WP_000547860.1.76125 WP_000547860.1.76783 WP_000547860.1.77668 WP_000547860.1.77824 WP_000547860.1.782 WP_000547860.1.78644 WP_000547860.1.79315 WP_000547860.1.79584 WP_000547860.1.80439 WP_000547860.1.80695 WP_000547860.1.81799 WP_000547860.1.82289 WP_000547860.1.83951 WP_000547860.1.84045 WP_000547860.1.85689 WP_000547860.1.85901 WP_000547860.1.86119 WP_000547860.1.86140 WP_000547860.1.86239 WP_000547860.1.86288 WP_000547860.1.8698 WP_000547860.1.8825 WP_000547860.1.88641 WP_000547860.1.90155 WP_000547860.1.90596 WP_000547860.1.90791 WP_000547860.1.90883 WP_000547860.1.9186 WP_000547860.1.92686 WP_000547860.1.9269 WP_000547860.1.92831 WP_000547860.1.93271 WP_000547860.1.93744 WP_000547860.1.93893 WP_000547860.1.93927 WP_000547860.1.94237 WP_000547860.1.94322 WP_000547860.1.94373 WP_000547860.1.94784 WP_000547860.1.95308 WP_000547860.1.96934 WP_000547860.1.97781 WP_000547860.1.97861 WP_000547860.1.98216 WP_000547860.1.99445 WP_000547860.1.99485 WP_000547860.1.99994 YP_030610.1.16718 YP_038516.1.62562 gi|386738359|ref|YP_006211540.1| 198094.BA_4698 260799.BAS4363 261594.GBAA4698 281309.BT9727_4199 405535.BCAH820_4553 412694.BALH_4059 568206.BAMEG_4733 592021.BAA_4716 gi|376268389|ref|YP_005121101.1| gi|49187358|ref|YP_030610.1| gi|118479632|ref|YP_896783.1| gi|227817246|ref|YP_002817255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]