SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229600734|ref|YP_002868471.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229600734|ref|YP_002868471.1|
Domain Number 1 Region: 5-193,239-378
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.93e-74
Family TK-like PP module 0.0096
Further Details:      
 
Domain Number 2 Region: 317-502
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.69e-53
Family TK-like Pyr module 0.022
Further Details:      
 
Domain Number 3 Region: 490-623
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.22e-32
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229600734|ref|YP_002868471.1|
Sequence length 630
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Bacillus anthracis str. A0248]
Sequence
MDLTQIQNPSFLKDMSISELEGLSEDIRKFLIEELSQTGGHIAPNLGVVELTIALHKLFD
SPKDKFLWDVGHQSYVHKILTGRAKEFGTLRQYQGLCGFPKRCESEHDVWETGHSSTSLS
AAMGMALARDLKKTKEYVIPIIGDGALTGGMALEALNHIGHEKTDMIVILNDNEMSIAPN
VGALHNVLGRLRTAGKYHWVKDELEYILKKIPAVGGKVAATAEKIKDSLKYLLVSGVFFE
ELGFTYLGPVDGHDYEKLFETLQYAKKTKGPVLVHVITKKGKGYKPAESDVIGTWHGTGP
YKIESGDFVKPKEVAPAWSAVVSETVLKLARTDERIVAITPAMPVGSKLEKFQKEFPDRM
IDVGIAEQHATTMAAGMATQGMKPFLAIYSTFLQRAYDQVVHDICRQNLNVFIGIDRSGL
VGADGETHQGVFDISFLRHLPNMVIMMPKDENEGQHLVYTAMQYEDGPIALRYARGNGLG
VHMDEELKAIPIGSWETLKEGTQAAILTFGTTIPMAMEAAERLEKAGVSVKVVNARFIKP
MDEAYLHDLLGKNIPILTIEEACLIGGFGTGVVEFASENGYHSALVERMGIPDRFIEHGS
VTKLLEEIGLTTDAVVDRIHTMIPSKQKRA
Download sequence
Identical sequences A0A0B5XR24 A0A0B5ZQC7 A0A0G8E940 A0A0U0DZX3 A0A154AS28 A0A1J9VC96 A0A1S9BLH1 A0A243CNU8 A0A246UCI5 B3ZEK3 B7JM28 C2NMM9 C3LJV1 C3P7V6 Q635A7 Q6HDY8 Q81M54
gi|376268074|ref|YP_005120786.1| gi|47529695|ref|YP_021044.1| gi|52141319|ref|YP_085510.1| gi|386738068|ref|YP_006211249.1| gi|49187079|ref|YP_030331.1| gi|229600734|ref|YP_002868471.1| NP_846629.1.87267 WP_000366447.1.100059 WP_000366447.1.100214 WP_000366447.1.100409 WP_000366447.1.100595 WP_000366447.1.101931 WP_000366447.1.10208 WP_000366447.1.11387 WP_000366447.1.11427 WP_000366447.1.11676 WP_000366447.1.12289 WP_000366447.1.13115 WP_000366447.1.13221 WP_000366447.1.13233 WP_000366447.1.13820 WP_000366447.1.14721 WP_000366447.1.14855 WP_000366447.1.15163 WP_000366447.1.15460 WP_000366447.1.15569 WP_000366447.1.16013 WP_000366447.1.16156 WP_000366447.1.16170 WP_000366447.1.16997 WP_000366447.1.17146 WP_000366447.1.18976 WP_000366447.1.19258 WP_000366447.1.19435 WP_000366447.1.19445 WP_000366447.1.20390 WP_000366447.1.20665 WP_000366447.1.20680 WP_000366447.1.20865 WP_000366447.1.21021 WP_000366447.1.21258 WP_000366447.1.21776 WP_000366447.1.22865 WP_000366447.1.23269 WP_000366447.1.23615 WP_000366447.1.23873 WP_000366447.1.2419 WP_000366447.1.24334 WP_000366447.1.24556 WP_000366447.1.24608 WP_000366447.1.24676 WP_000366447.1.25316 WP_000366447.1.2569 WP_000366447.1.25716 WP_000366447.1.25752 WP_000366447.1.26000 WP_000366447.1.2618 WP_000366447.1.26665 WP_000366447.1.26721 WP_000366447.1.27644 WP_000366447.1.27987 WP_000366447.1.28427 WP_000366447.1.28729 WP_000366447.1.29101 WP_000366447.1.29451 WP_000366447.1.29787 WP_000366447.1.29804 WP_000366447.1.30110 WP_000366447.1.30216 WP_000366447.1.30336 WP_000366447.1.31490 WP_000366447.1.3236 WP_000366447.1.32576 WP_000366447.1.33175 WP_000366447.1.33338 WP_000366447.1.33367 WP_000366447.1.33536 WP_000366447.1.33740 WP_000366447.1.33828 WP_000366447.1.33876 WP_000366447.1.34158 WP_000366447.1.34646 WP_000366447.1.35684 WP_000366447.1.35886 WP_000366447.1.36305 WP_000366447.1.36763 WP_000366447.1.3699 WP_000366447.1.38036 WP_000366447.1.39781 WP_000366447.1.40550 WP_000366447.1.41165 WP_000366447.1.41365 WP_000366447.1.41675 WP_000366447.1.42217 WP_000366447.1.43104 WP_000366447.1.4439 WP_000366447.1.44483 WP_000366447.1.45305 WP_000366447.1.45385 WP_000366447.1.45533 WP_000366447.1.45919 WP_000366447.1.46236 WP_000366447.1.46476 WP_000366447.1.4649 WP_000366447.1.46549 WP_000366447.1.46699 WP_000366447.1.47145 WP_000366447.1.4763 WP_000366447.1.47644 WP_000366447.1.47798 WP_000366447.1.49831 WP_000366447.1.51167 WP_000366447.1.51749 WP_000366447.1.52794 WP_000366447.1.53137 WP_000366447.1.53493 WP_000366447.1.53683 WP_000366447.1.53879 WP_000366447.1.54117 WP_000366447.1.54189 WP_000366447.1.55811 WP_000366447.1.55958 WP_000366447.1.56042 WP_000366447.1.56176 WP_000366447.1.56270 WP_000366447.1.56318 WP_000366447.1.56580 WP_000366447.1.56959 WP_000366447.1.58160 WP_000366447.1.59095 WP_000366447.1.59173 WP_000366447.1.59310 WP_000366447.1.59575 WP_000366447.1.59978 WP_000366447.1.60402 WP_000366447.1.61213 WP_000366447.1.62300 WP_000366447.1.63137 WP_000366447.1.63560 WP_000366447.1.63611 WP_000366447.1.64491 WP_000366447.1.66331 WP_000366447.1.66357 WP_000366447.1.68607 WP_000366447.1.69203 WP_000366447.1.69323 WP_000366447.1.69822 WP_000366447.1.69894 WP_000366447.1.70065 WP_000366447.1.7096 WP_000366447.1.70996 WP_000366447.1.71953 WP_000366447.1.72704 WP_000366447.1.73325 WP_000366447.1.74226 WP_000366447.1.74337 WP_000366447.1.74538 WP_000366447.1.7545 WP_000366447.1.75499 WP_000366447.1.75870 WP_000366447.1.76125 WP_000366447.1.76783 WP_000366447.1.77668 WP_000366447.1.77824 WP_000366447.1.782 WP_000366447.1.7856 WP_000366447.1.78644 WP_000366447.1.79315 WP_000366447.1.79584 WP_000366447.1.80439 WP_000366447.1.80695 WP_000366447.1.81799 WP_000366447.1.82289 WP_000366447.1.83951 WP_000366447.1.84045 WP_000366447.1.85689 WP_000366447.1.86119 WP_000366447.1.86140 WP_000366447.1.86239 WP_000366447.1.86288 WP_000366447.1.8698 WP_000366447.1.8825 WP_000366447.1.88641 WP_000366447.1.90155 WP_000366447.1.90596 WP_000366447.1.90791 WP_000366447.1.90883 WP_000366447.1.9186 WP_000366447.1.92686 WP_000366447.1.9269 WP_000366447.1.92831 WP_000366447.1.93271 WP_000366447.1.93744 WP_000366447.1.93893 WP_000366447.1.93927 WP_000366447.1.94322 WP_000366447.1.94373 WP_000366447.1.94784 WP_000366447.1.95308 WP_000366447.1.96934 WP_000366447.1.97149 WP_000366447.1.97781 WP_000366447.1.97861 WP_000366447.1.98216 WP_000366447.1.99445 WP_000366447.1.99454 WP_000366447.1.99485 WP_000366447.1.99994 YP_030331.1.16718 YP_038238.1.62562 BuR104 gi|227816953|ref|YP_002816962.1| gi|49480923|ref|YP_038238.1| 198094.BA_4400 260799.BAS4081 261594.GBAA4400 281309.BT9727_3919 288681.BCZK3930 405535.BCAH820_4197 568206.BAMEG_4436 592021.BAA_4418 gi|30264252|ref|NP_846629.1| gi|218905313|ref|YP_002453147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]