SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229604873|ref|YP_002867596.1| from Bacillus anthracis str. A0248

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229604873|ref|YP_002867596.1|
Domain Number 1 Region: 6-334
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.71e-109
Family TK-like PP module 0.000000035
Further Details:      
 
Domain Number 2 Region: 355-536
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.23e-68
Family TK-like Pyr module 0.00000951
Further Details:      
 
Domain Number 3 Region: 541-673
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.96e-39
Family Transketolase C-terminal domain-like 0.0000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229604873|ref|YP_002867596.1|
Sequence length 674
Comment transketolase [Bacillus anthracis str. A0248]
Sequence
MTQNINQLAVNTIRTLSIDAINAANSGHPGLPMGAAPMAYALWANHLNHNPNHPKWFNRD
RFVLSAGHGSSLLYSLLHLAGYDVSIDDLKNFRKLNSKTPGHPEFGHTSGVEATTGPLGQ
GIANAVGMAMAEAHLAAKFNKDGHSIIDHNTYALVGDGDLMEGVAYEAMSMEGVAYEAMS
MAGHMKLGKLIVLYDSNEISLDGELNIAFSEDMQKRVESAHWQYVRVEDGNDVDAITKAI
QLAKDNTDQPTLIEIRTVIGYGSPKVAGTNKAHGNPLGLEEATATKQVYGWHYEEDFFVP
EEVTAHFNELKQKGIEKERGWNEQFNLYRESNPALADELEKAIIGEVLIEAKDILSFDSE
KTISTRVASGEAINHYVKSIPSIFGGSADLSHSTMTDIKGEAVYAVESYAGRNIYFGVRE
HAMGAAANGLALHGGVKPFVSTFFVFNDYLRPSIRLAALQKLPVTYVFTHDSIAVGEDGP
THEPIEHLAALRAIPGLTVIRPSDANETASAWAYALQQTEGPVVLVLSRQNLPVFHETKA
NIENLSKGAYVLTQTNENPDVILIATGSEVSLAASAKAKLEEDNVSVRIVAMPSWELFDR
QSKEYKESVLPSSVTKRVSLEMGVSLGWERYVGQEGNILSIETFGASGTGAEVMNLFGFT
TENVVQITKNVLNS
Download sequence
Identical sequences Q81MY7
IDP02703 gi|47528718|ref|YP_020067.1| gi|49186186|ref|YP_029438.1| gi|229604873|ref|YP_002867596.1| gi|30263339|ref|NP_845716.1| 198094.BA_3432 260799.BAS3181 261594.GBAA3432 592021.BAA_3466 NP_845716.1.87267 WP_000193036.1.100214 WP_000193036.1.14721 WP_000193036.1.14855 WP_000193036.1.15460 WP_000193036.1.15569 WP_000193036.1.16997 WP_000193036.1.20680 WP_000193036.1.21776 WP_000193036.1.22865 WP_000193036.1.24556 WP_000193036.1.2618 WP_000193036.1.26665 WP_000193036.1.30110 WP_000193036.1.3236 WP_000193036.1.33367 WP_000193036.1.33740 WP_000193036.1.33876 WP_000193036.1.35684 WP_000193036.1.36763 WP_000193036.1.38036 WP_000193036.1.39781 WP_000193036.1.46236 WP_000193036.1.47145 WP_000193036.1.52794 WP_000193036.1.53137 WP_000193036.1.53493 WP_000193036.1.54189 WP_000193036.1.55958 WP_000193036.1.58160 WP_000193036.1.63560 WP_000193036.1.69894 WP_000193036.1.73325 WP_000193036.1.74538 WP_000193036.1.75870 WP_000193036.1.76125 WP_000193036.1.77668 WP_000193036.1.81799 WP_000193036.1.83951 WP_000193036.1.84045 WP_000193036.1.85689 WP_000193036.1.86119 WP_000193036.1.86140 WP_000193036.1.93271 WP_000193036.1.94237 WP_000193036.1.94784 WP_000193036.1.96934 WP_000193036.1.99485 YP_029438.1.16718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]