SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254788095|ref|YP_003075524.1| from Teredinibacter turnerae T7901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254788095|ref|YP_003075524.1|
Domain Number 1 Region: 16-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.62e-79
Family Acetamidase/Formamidase-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254788095|ref|YP_003075524.1|
Sequence length 410
Comment formamidase [Teredinibacter turnerae T7901]
Sequence
MTETIIKVDLNSSPYDNEKIHNRWHPDIPMAAMVKPGDDFIIECHDWTGGQIKDNDDASD
VRDVDLSQVHFLSGPVGVEGAEPGDLLVVDILDIGTFSDSEWGFNGFFSKNNGGGFLTDH
FPEAQKSIWDISGMFTKSRHVPGVEFAGLVHPGLIGCLPSKEMLEEWNTREKALYDTEPD
RIPALATLPYADTAHMGAMDADAAKTAAAEAARTVPPREHGGNCDIKDLSRGSKVYFPVY
VKDGGLSVGDLHFSQGDGEITFCGAIEMAGWIHMRVNLIKDGMKKYGIKNPIFKPSPITP
TYNDYLIFEGISVDEDGKQHYLDVHIAYRQACLNAIEYLTKFGYSRAQAYAILGTAPVQG
HISGVVDIPNACATLWLPTEIFDFSIQPGEDGPTKELDGSIDVPLAPDKP
Download sequence
Identical sequences C5BI86
WP_015819785.1.31564 WP_015819785.1.38994 WP_015819785.1.4287 WP_015819785.1.78565 gi|254788095|ref|YP_003075524.1| 377629.TERTU_4262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]