SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254784999|ref|YP_003072427.1| from Teredinibacter turnerae T7901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254784999|ref|YP_003072427.1|
Domain Number 1 Region: 21-353
Classification Level Classification E-value
Superfamily SIS domain 1.52e-71
Family double-SIS domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|254784999|ref|YP_003072427.1|
Sequence length 355
Comment glutamine-fructose-6-phosphate transaminase [Teredinibacter turnerae T7901]
Sequence
MSKAEEVSGAPIAAESTLMFQEAAAASAVVEQQFEANREKIIAAVEQIHAFAPRALVTMA
RGSSDHAATYAKYLAETRLSLLTSSAAPSVSSVYHAKQNLEQTLYLAISQSGKSPDLLAG
VETAKQSGALTVALVNVEDSPLAAMADIVLPLHAGAEKSVAATKSYIATLAGILNLIATY
TNDTELLNARDQLPAQLARAWANDWTAAGVDALREARNLFVIGRGYGFGVAQEAALKFKE
TCGLHAEAFSAAEVKHGPMAIVNAGFPVLVFAQQDETRSGTDALVSDFVARDARVLYAAE
NAPAGQALPVVEGAHAATAPILQVQSFYRLANALSVARGYNPDTPPHLNKVTETL
Download sequence
Identical sequences C5BPJ9
WP_015820736.1.78565 gi|254784999|ref|YP_003072427.1| 377629.TERTU_0815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]