SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254787551|ref|YP_003074980.1| from Teredinibacter turnerae T7901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254787551|ref|YP_003074980.1|
Domain Number 1 Region: 3-191
Classification Level Classification E-value
Superfamily SIS domain 3.59e-47
Family mono-SIS domain 0.00000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|254787551|ref|YP_003074980.1|
Sequence length 194
Comment phosphoheptose isomerase [Teredinibacter turnerae T7901]
Sequence
MSQRVYNIFQKSVEAKMQVGEELGPLIDHASELIVESLLADRKVMVCGNGTSSAMAQILT
SCLLDRYEKERPSLPAVWLGSSVSTYTALAADYNYSDIYAKPIRALGQEDDILVVISTSG
NSANLISAVQAAHDRGVKVIALTGRDGGDISSLLDVHDVEICAALNSRTRIHELHLLTIF
CLCDLIDHKLFGIE
Download sequence
Identical sequences C5BS53
377629.TERTU_3667 WP_015820169.1.31564 WP_015820169.1.38994 WP_015820169.1.4287 WP_015820169.1.78565 gi|254787551|ref|YP_003074980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]