SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254787684|ref|YP_003075113.1| from Teredinibacter turnerae T7901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254787684|ref|YP_003075113.1|
Domain Number 1 Region: 7-320
Classification Level Classification E-value
Superfamily SIS domain 2.22e-72
Family mono-SIS domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|254787684|ref|YP_003075113.1|
Sequence length 322
Comment arabinose 5-phosphate isomerase [Teredinibacter turnerae T7901]
Sequence
MSETDLIQSAQRTIALEIAAVQALEERINGEFVAACEKILSCSGRVVVSGMGKSGHIGKK
IAATLASTGTPAFFVHPGEASHGDLGMITRDDVFLCISNSGNSPEMVAILPWIKRMGIPV
VAMTGKSNSPLAEAADVILDIAVATEACPLDLAPTSSTTVTLVLGDALALALLEARGFTA
EDFAYSHPGGTLGRRLLLHVADVMHDGETVPIVTTTTPVLEALGEMSRKGFGITTVVDAT
GELVGVFTDGDLRRCLDRDIEVKNASIEQVMSRGGRTITPQALAAEAFNLMETHKITALV
VTDNNKPVGILHMHDMLQAGLV
Download sequence
Identical sequences C5BSW8
WP_015818462.1.4287 WP_015818462.1.78565 gi|254787684|ref|YP_003075113.1| 377629.TERTU_3816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]