SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258513426|ref|YP_003189648.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258513426|ref|YP_003189648.1|
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily L28p-like 2.9e-25
Family Ribosomal protein L31p 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258513426|ref|YP_003189648.1|
Sequence length 68
Comment 50S ribosomal protein L31 [Desulfotomaculum acetoxidans DSM 771]
Sequence
MLKSGIHPEYRTIKVKCVCGNEFNTGSVRKEDLRVEICSNCHPFYTGTQRTIETGGRAER
FRKKYGIS
Download sequence
Identical sequences C8VVF9
485916.Dtox_0062 gi|258513426|ref|YP_003189648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]