SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258513936|ref|YP_003190158.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258513936|ref|YP_003190158.1|
Domain Number 1 Region: 156-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.75e-68
Family Methylesterase CheB, C-terminal domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 4-106
Classification Level Classification E-value
Superfamily CheY-like 1.71e-27
Family CheY-related 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258513936|ref|YP_003190158.1|
Sequence length 347
Comment response regulator receiver modulated CheB methylesterase [Desulfotomaculum acetoxidans DSM 771]
Sequence
MIKKKIKVLVVDDSLVFRETLAKSISKDPGIEVVGTASDPFMARDKILELEPDVLTLDVE
MPKMSGIEFLKRLMPQYPIPVIMVSSVGENVFDALNAGAVDFVAKPNFGIEKGIDALINE
LIVKIKIASTARLSHWKNKSTCSGIVGKDNGHAGNSIIAIGASTGGTEAILSILKQFPGN
MPGIVIVQHMPPVFTKMYAQRLNNSCLLEVKEAQKGDRVLPGTVLIAPGDYHMRIKKAGD
NYSVECLKGEKVNGHCPSVDVLFESVAEKAGSAAIGVILTGMGHDGARGLLSMRKKGALT
IGQNEETCVVYGMPKVAYEIGAVQKQSSLLSIPQLIYSMLDNIQKYR
Download sequence
Identical sequences C8W0W6
485916.Dtox_0615 gi|258513936|ref|YP_003190158.1| WP_015756254.1.30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]