SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258513977|ref|YP_003190199.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258513977|ref|YP_003190199.1|
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.18e-46
Family Methylesterase CheB, C-terminal domain 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258513977|ref|YP_003190199.1|
Sequence length 160
Comment CheB methylesterase [Desulfotomaculum acetoxidans DSM 771]
Sequence
MVLVQRFPVGFSQALAESLGRKCRLTVSHAVHGEAVRPGHVLVAPAGMEFTFQGRPGSVT
VNLSHGKAPVSLGSFRPSVDVVMTSAARTYGDRVMGVLLTGMGRDGAQGMLEIKKVRGRT
IAQDESTCVVFGMPKEAIKLGAADKVSPLPEIPADILNML
Download sequence
Identical sequences C8W1D1
gi|258513977|ref|YP_003190199.1| 485916.Dtox_0661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]