SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258514449|ref|YP_003190671.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258514449|ref|YP_003190671.1|
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily L28p-like 2.94e-26
Family Ribosomal protein L28 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258514449|ref|YP_003190671.1|
Sequence length 63
Comment 50S ribosomal protein L28 [Desulfotomaculum acetoxidans DSM 771]
Sequence
MARKCDICGKGVVTGMKVSHSHIRTKRTWAPNLQRVKAIVNGSPKRIMVCTRCLRSGKVQ
RAV
Download sequence
Identical sequences C8W566
gi|258514449|ref|YP_003190671.1| 485916.Dtox_1163 WP_015756763.1.30109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]