SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258514651|ref|YP_003190873.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258514651|ref|YP_003190873.1|
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily Hsp33 domain 1.24e-70
Family Hsp33 domain 0.00000027
Further Details:      
 
Domain Number 2 Region: 231-289
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 7.98e-19
Family HSP33 redox switch-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258514651|ref|YP_003190873.1|
Sequence length 293
Comment Hsp33 protein [Desulfotomaculum acetoxidans DSM 771]
Sequence
MQDYLIRAVGKKGQFRVIAAVTTGLVEEARRRHSTWPVASAALGRTLTAGLLLGANLKGD
DLLTVRVRGDGPLGAIIVSANGHGDVRGYVQNPQIHVPGIRPGKLGVGNAVGKGTLSVSK
DLGLREPFTGSVELVSGEIGEDIAYYLLASEQTPSAVSLGVLVETDNSVRAAGGLIVQLL
PGAEENMLAELEDCLNRLPPISSLVNEGKIPEEIVKLALGNLDIDIIDNTPVRFYCSCTR
ERIERMLAGLGEQELRDIYETTGQVEVICHFCGEKYNIQEQELGKLLQDIKKE
Download sequence
Identical sequences C8W6G1
485916.Dtox_1374 WP_015756965.1.30109 gi|258514651|ref|YP_003190873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]