SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258514240|ref|YP_003190462.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258514240|ref|YP_003190462.1|
Domain Number 1 Region: 71-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.82e-38
Family Phosphate binding protein-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258514240|ref|YP_003190462.1|
Sequence length 320
Comment family 3 extracellular solute-binding protein [Desulfotomaculum acetoxidans DSM 771]
Sequence
MERKNVPIYLFIIMLVLLFISKLPGTQTFSTEQKNTGNAQAVPAAAEKNQDNSTTTVQAP
AVSLNDKNVSPDIQKILSRGKLIVGLYCNDQPPFFMLNPQGKLYGMDIALAKDIAAKLGV
ALEFNRSARTFNELTEMVARGDVDTAISVLSRTLDRAKLISFTKPYVVLHQALLVNRVEA
AKKGIEDYPMDYLKKEDVKIGVKAKTSYVEFARELFPKAHILEYKEWEDVVAALLKGEVI
AAVNDENEITQLINKRPNISLYACVYILKDKKDYICMGVSQQNTHLLDWLNTYLDNYDIN
MNVKSIMEEYPEIYKQNPAK
Download sequence
Identical sequences C8W372
WP_015756554.1.30109 gi|258514240|ref|YP_003190462.1| 485916.Dtox_0948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]