SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258517268|ref|YP_003193490.1| from Desulfotomaculum acetoxidans DSM 771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258517268|ref|YP_003193490.1|
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.67e-71
Family Phosphate binding protein-like 0.000000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258517268|ref|YP_003193490.1|
Sequence length 282
Comment hypothetical protein Dtox_4199 [Desulfotomaculum acetoxidans DSM 771]
Sequence
MKIVFSPCPNDTFIFHAWVHGLVPGAPELDVALADIDVTNKLAAGPNGPDIIKISFAALP
WVLSKYALLPCGGALGRGCGPLVLVANKPCGIINPADLAGRRVAVPAERSTAYLLFRLWL
DQHVPGGVGEIIILPFHEIMPAVRDGLVDAGLVIHESRFTYPSFGLTLLVDLGSWWESDT
NLPIPLGAIVARRTLDLSAITGWLRESVKYAWAHPEASQEYVLRHAQELSPEVAKAHIRL
YVNEFTLNLGEGYGAVISLLSRAAQAGLIPDVNLSKLSLTEL
Download sequence
Identical sequences C8VZC2
WP_015759537.1.30109 gi|258517268|ref|YP_003193490.1| 485916.Dtox_4199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]