SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239916901|ref|YP_002956459.1| from Micrococcus luteus NCTC 2665

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239916901|ref|YP_002956459.1|
Domain Number 1 Region: 13-175
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.71e-33
Family Phosphoglucomutase, first 3 domains 0.00017
Further Details:      
 
Domain Number 2 Region: 164-270
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.77e-27
Family Phosphoglucomutase, first 3 domains 0.00012
Further Details:      
 
Domain Number 3 Region: 285-383
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.03e-24
Family Phosphoglucomutase, first 3 domains 0.0017
Further Details:      
 
Domain Number 4 Region: 386-489
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.0000000000000109
Family Phosphoglucomutase, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239916901|ref|YP_002956459.1|
Sequence length 491
Comment phosphomannomutase [Micrococcus luteus NCTC 2665]
Sequence
MTTSTPSLDLHDSFKAYDVRGIVGESITAESVRAVGAAFVDVLGLAGQTVLVGGDMRPSS
PAFMTAFAEGATRRGADVVTLGLISTDMLYYAAGVKQAAGVVFTASHNPAEYNGMKMAQA
GAVPVSSDTGLFEIRDAAQAYLDAGEIPAAETAGTVTEEDILPGYAAYLRSLVDLTGVRR
LKVVVDAGNGMAGKTTPAVLGDAELAALPLEIEPLYFELDGTFPNHPANPLEPENLRDLQ
AAVVEHGADIGLAFDGDADRCFVIDEQGTPVSPSAITALVARREIARAKADGEQTPVVIH
NLITSRAVPELVAADGGRAVETRVGHSFIKAVMAAESAVFGGEHSAHYYFRDFFNADTGM
LAAMHVLAALGGQEQPLSELAEEYEPYVASGEINSQVEDKDAAVAAVVAQFAPAVGEGAG
EGQAVHEDFAGVATTVTRMDGTTVAAQDGTWWFNLRPSNTEPFLRYNGEARTAATMEALR
DAVLAIVRAER
Download sequence
Identical sequences C5C8V3
WP_010079468.1.25715 WP_010079468.1.54265 WP_010079468.1.79382 WP_010079468.1.79589 gi|239916901|ref|YP_002956459.1| 465515.Mlut_03540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]