SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239917001|ref|YP_002956559.1| from Micrococcus luteus NCTC 2665

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239917001|ref|YP_002956559.1|
Domain Number 1 Region: 100-301
Classification Level Classification E-value
Superfamily Formyltransferase 1.03e-56
Family Formyltransferase 0.00021
Further Details:      
 
Domain Number 2 Region: 17-96
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000196
Family SP0238-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|239917001|ref|YP_002956559.1|
Sequence length 301
Comment formyltetrahydrofolate deformylase [Micrococcus luteus NCTC 2665]
Sequence
MDTAALSPSPSPASGAEHAHVLTLACTNRKGIVHAVTGALLGVEADITESQQYDSPDTGD
FFMRVEFVTPATREDIEQALAPVREEFGMRMGLWDAAQRMRTLVMCSKDGHTLNDLLFQQ
RAGTLPIEIPVVVSNHLDLQPLASFYGVPFIHVPVSKDPSSRDSKEAAEGRLRDLIAQFD
IELVVLARYMQILSDELCRDLAGMAINIHHSFLPSFKGARPYHQAHERGVKLIGATAHYV
TADLDEGPIIAQSVQPVTHAQTAADFVARGRDVEGSTLAQAVRWHAQHRVLADGRRTVVF
S
Download sequence
Identical sequences C5C953
465515.Mlut_04640 gi|239917001|ref|YP_002956559.1| WP_010079366.1.25715 WP_010079366.1.54265 WP_010079366.1.79382 WP_010079366.1.79589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]