SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|239917584|ref|YP_002957142.1| from Micrococcus luteus NCTC 2665

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|239917584|ref|YP_002957142.1|
Domain Number 1 Region: 6-205
Classification Level Classification E-value
Superfamily Formyltransferase 7.06e-51
Family Formyltransferase 0.00000387
Further Details:      
 
Domain Number 2 Region: 213-322
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 0.0000000000000589
Family Post formyltransferase domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|239917584|ref|YP_002957142.1|
Sequence length 366
Comment methionyl-tRNA formyltransferase [Micrococcus luteus NCTC 2665]
Sequence
MTAPTPLRVLYAGTPETAVPALRALLDSPHEVVGVLTRPDAPVGRRRVLTPSPVAVTAEE
AGLPVLKADRLRGPEGADALQAIRALEADVAVVVAYGALVPAEALQIPRHGWLNLHFSAL
PAYRGAAPVQRAVMAGETEIAADVFQLEEGLDTGPVFARLTRPVAADETAGAVLTDLAER
GGPLVIDVLDRLADGTATATPQRGEPTHAPKLTAADGLVDPARPAAEVAARINGVTPEPG
AWGWLTADDGAAPARFKLDGVAPVRAGDDGWPSDLDAAAPGQILVAAKAAWLRTAGGAVR
LSRVQPAGRKLMPAADWARGAAAGAALLAGDELADHEAQVCQEAAARAAAREAARNTAAQ
DEEAHA
Download sequence
Identical sequences C5CBJ1
WP_012750863.1.25715 WP_012750863.1.54265 WP_012750863.1.79589 465515.Mlut_10800 gi|239917584|ref|YP_002957142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]