SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222524029|ref|YP_002568499.1| from Chloroflexus sp. Y-400-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222524029|ref|YP_002568499.1|
Domain Number 1 Region: 107-212
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 7.72e-24
Family Siroheme synthase middle domains-like 0.0035
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.85e-19
Family Siroheme synthase N-terminal domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222524029|ref|YP_002568499.1|
Sequence length 226
Comment siroheme synthase [Chloroflexus sp. Y-400-fl]
Sequence
MYYPVMLDLRDKKVLFIGGGIETEVKVQRLVDAGARVRLISPFDHPALDALVQDGRLDWQ
RRAYHYGDLVGFMLCFVHLPDTTLNATIAAEARERGVWLNAVDDPPHCDFILPSIHRQGD
LVIAISTSGVAPALAVRIKEHLSAVYGPEYAAFLDVLRSFRSLVKQAYPHSFAERRAAWY
RLVDSGALAMLRAGDYVQAQNLLWQALYDTASAVPVDLSLHQQEVV
Download sequence
Identical sequences A9WFJ0
gi|222524029|ref|YP_002568499.1| 324602.Caur_0688 480224.Chy400_0744 WP_012256584.1.35445 YP_001634317.1.55443 377841 gi|163846273|ref|YP_001634317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]