SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222524343|ref|YP_002568814.1| from Chloroflexus sp. Y-400-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222524343|ref|YP_002568814.1|
Domain Number 1 Region: 2-548
Classification Level Classification E-value
Superfamily Urocanase 3.01e-246
Family Urocanase 0.000000000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222524343|ref|YP_002568814.1|
Sequence length 549
Comment urocanate hydratase [Chloroflexus sp. Y-400-fl]
Sequence
MSRIVRAPRGTTLTCANWQIEAAYRMIQNNLDPDVAFDPDHLIVYGGRGRAARNWECFDA
ILATLRRLRPDETLIVQSGKPVAVFRTHTDAPRVLIANANLVPAWATQANFDRWEAAGLT
MYGQMTAGSWIYIGTQGILQGTYETFGALARSAGWGTLRGRLVVTAGLGEMGGAQPLAVT
LNEGVLIAVEIDRWRAERRLRLRQVDRLSDDLEEAMTWAEEARASGTPLSIALIGNAAEL
LPEMLRRGVVPDVATDQTSAHDVRYGYIPAGLSLAEAAELRERDPAEYDRRALASMAEHV
RTLLEWQRRGSIVFDYGNNLRQRAFDAGVHDAFNYPGFVPAYIRPLFCEGKGPFRWVALS
GDPEDIYVTDRAIAELFPHDEHLGRWLRLARDHVAFQGLPARICWLGYGERAQAGLLLND
LVARGIVKAPIVIGRDHLDAGSVASPNRETEGMRDGSDAIADWPLLNALINAVGGATWVS
IHHGGGVGIGYSIHAGQVIVADGTPEAARRIERVLTTDPGMGVVRHADAGYPEAIAFARR
HGIDMPMLE
Download sequence
Identical sequences A9WHU0
WP_012256864.1.35445 YP_001634597.1.55443 gi|222524343|ref|YP_002568814.1| gi|163846553|ref|YP_001634597.1| 324602.Caur_0976 480224.Chy400_1066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]