SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222525089|ref|YP_002569560.1| from Chloroflexus sp. Y-400-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222525089|ref|YP_002569560.1|
Domain Number 1 Region: 67-101,133-216
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.00000204
Family MJ1460-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222525089|ref|YP_002569560.1|
Sequence length 225
Comment 4-vinyl reductase 4VR [Chloroflexus sp. Y-400-fl]
Sequence
MEIRDRSDHDPVADLLLVDAYMRWALLAAEEVIGRNGLAVVLRQAGLSHLIGNYPPEQLK
ATTGLTFYHYASLNAGLINFFGRSARSMALRIGRQTARLAIANQSALFGTAALIASKVLP
FATQVKLGLSAMQAGLRRLSQAVNQDRRLALEDRGEAWAYIDYTCSMSAGKQADEPIGYI
QCGVLQEALHWQTGREFAVEQIACRSMGAPASIWLVSKTPTLPYN
Download sequence
Identical sequences A9WCB2
324602.Caur_1685 480224.Chy400_1826 WP_012257557.1.35445 YP_001635292.1.55443 gi|222525089|ref|YP_002569560.1| gi|163847248|ref|YP_001635292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]