SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222526016|ref|YP_002570487.1| from Chloroflexus sp. Y-400-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222526016|ref|YP_002570487.1|
Domain Number 1 Region: 2-179,210-243
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 3.14e-57
Family CbiG N-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 362-612
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 2.09e-55
Family Tetrapyrrole methylase 0.002
Further Details:      
 
Domain Number 3 Region: 229-354
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 1.96e-33
Family CobE/GbiG C-terminal domain-like 0.00086
Further Details:      
 
Domain Number 4 Region: 629-738
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.46e-19
Family Siroheme synthase N-terminal domain-like 0.0019
Further Details:      
 
Domain Number 5 Region: 735-777
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.00000405
Family Siroheme synthase middle domains-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222526016|ref|YP_002570487.1|
Sequence length 783
Comment precorrin-3B C(17)-methyltransferase [Chloroflexus sp. Y-400-fl]
Sequence
MTTTAIFALTRNGVELATRLAATLPATIWLPERFAAFAPGGRCYTNLSAAVQTAWQQSKA
IILIAATGIAVRLIAPLLQAKTSDPAVICLDEQGHVVVPLIGGHRAGANALARQIAALTG
GQAAITTASDGQGLPALDLIGQAQGWRIATDSATTHVMACLVNGDPIGVWVDPDLPAARA
LLGAELAPVATVEWVADSEELTNPRFAAAIVVSHRRLDPLWHKLRDKGLRYMPPVLVIGI
GCRRDVPVHELATAVSATLATADLAPECVATIATADLKADEAGISDLARQLGVPLTIVTT
AQLQTLDPTAFSPSAASRFDIPGVAEPCATLVAQGPLLVPKQRFARCTVAVALQQATFGS
DTTPTGQLTLVSIGPGDLAHLTEAARLALIKAEVITGYARYIDLIRPLLRPDQEVIATPA
MGDEMGRARHAIELARSGRRVALISSGDIGIYAMAAPVFENLQAGGWDGRHPQVEVIPGV
SAFQALAARIGAPINHDLCLISLSDLLTPWPLIERRLRAAAHADFVVALYNPRSQGRNWQ
LATALSILRDHRPATTPVVFGRQVSREDEQITITTLADADPQQADMLTLVLIGNSQSFHL
AGHVVTPRGYTTQPARPSDFLMSNKTTDYPIVITKPAHMPAVVIGGGAVGERKVRGLLAA
GIPVRLISPTATDQLMAWAQEGRLIWERRTYQSGDLTGARLVFAATNDRAVNARIAAAAI
AAGALCNVADAPDEGDFHVPAIYRSGGITITVSSAGTAPGRAVALRDAIADWLDSIGVHN
HER
Download sequence
Identical sequences A9WIP4
gi|222526016|ref|YP_002570487.1| NYSGXRC-10037k WP_012258424.1.35445 YP_001636160.1.55443 324602.Caur_2565 480224.Chy400_2772 gi|163848116|ref|YP_001636160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]