SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222526544|ref|YP_002571015.1| from Chloroflexus sp. Y-400-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222526544|ref|YP_002571015.1|
Domain Number 1 Region: 9-175
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.000000000000199
Family Biotin dependent carboxylase carboxyltransferase domain 0.037
Further Details:      
 
Domain Number 2 Region: 359-427
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000405
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222526544|ref|YP_002571015.1|
Sequence length 436
Comment hypothetical protein Chy400_3311 [Chloroflexus sp. Y-400-fl]
Sequence
MLVGLLWMLLATGVAAQSVQPIYFVEYDGVLSSYAAGYLRRALREAEAANAQALIVQLTP
RGAVMQEARTLAGEIAEAKVPVVVFISPAGHDAGAAGTWLLAAAHVAAMAPESQFGIAAP
LFVPAMGVSETTQELLLNEQLQQFEEWGAARQRDVSWADVALRSGFIATAAQAIEGSPPI
IDIVARDVDELLLRLEGRVITLADGSQVTLATLGGRPRVVEVNLIEAVLLVLANPTVVFI
LLIMAGLAFYAEFLSPTVGILAGLGVILLAGAIVGMIALPVQWLSVLGILIAFGLVAADL
FVPSHGTLTVIGVGIMIASSLTLFDQVQAPGVTVALWAVILVAVLIAIFAISGVWLALRS
RNRPVTTGQEGLIGRLAEVRKRLDPEGMVFVEGALWRAVCENGTAEEGEFVRVTGIYALR
LTVRRIDTGESSPPQL
Download sequence
Identical sequences 480224.Chy400_3311 gi|222526544|ref|YP_002571015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]