SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222525061|ref|YP_002569532.1| from Chloroflexus sp. Y-400-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222525061|ref|YP_002569532.1|
Domain Number 1 Region: 368-475
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.08e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 
Domain Number 2 Region: 224-323
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000011
Family Heme-binding PAS domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222525061|ref|YP_002569532.1|
Sequence length 479
Comment putative PAS/PAC sensor protein [Chloroflexus sp. Y-400-fl]
Sequence
MELLAILFTIVILVASIVYVLLQDYRATANRIFALFTTASLLLSCAGAVRFASRSQTEIW
LLSGLLTSLQAATFGLLIWLILILFMPHRYNQPAIRWATISPYMVMAIGLAIDWYGRFGF
VGRDVFREESGILTFVRGPAFWPVFALYIIGCIVIPVTMLVTLAVRHPAVRSPTIWLTTG
TLLTLVTGYFSREIGLTALTYASLLPIHLSFGWVTIKYGLFRPSQVALQAAVEHLPDGVL
VLDAKHRVRFANRAAQQLVALEIGCGLEEVLHEAGFVEQNTVSDHRPGYRRFVRGNERVL
LLSEVVIRDERGGSSVVLLRDVTIVERQQAELLASQAILSERSAALERSLAELRQRDELL
RRLTLPIIPLSSTTLVVPLIGMFDAERCQTLVQLILNETAARQVRVVLIDVTGLTVFDQT
LAHTLNQLNQGARLMGAQIVLCGIRPDLAEVMIHTGSMWDGIRSFATLQDGVSALLVAR
Download sequence
Identical sequences A9WBR8
WP_012257529.1.35445 YP_001635264.1.55443 324602.Caur_1657 480224.Chy400_1798 gi|163847220|ref|YP_001635264.1| gi|222525061|ref|YP_002569532.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]