SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557693448|ref|YP_008796502.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693448|ref|YP_008796502.1|
Domain Number 1 Region: 8-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.6e-53
Family Extended AAA-ATPase domain 0.000000934
Further Details:      
 
Domain Number 2 Region: 234-322
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 4.68e-17
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557693448|ref|YP_008796502.1|
Sequence length 327
Comment replication factor C small subunit [Candidatus Caldiarchaeum subterraneum]
Sequence
MSASDVKNLPWVEKYRPRRLDDVVNQEQVVEALKNIVVSKNVPHMLFAGPPGTGKTATAH
AFAQDLFGPRYIEDGHFIEINASDERGIETIRERVKTYARSVPFGGIGFRLLLLDESDQL
TDAAQHAFRRTMEQFSTTCRFILAANYSNRIIEPIQSRCAVLRFKPLSKDMVETMLKKIA
ASENIKLDDSAIDAIYEFSLGDMRKAINILQSAASISKTIDSKTIYDVMGVVSRGEITRM
LQLVLDGKFIEARNLLRELLYVQGYQPTDIVSSIAREIPLLPVSEQDKLRLMDLIGETDY
RISEGGTPEVQLQAFLAKLALVKRSGA
Download sequence
Identical sequences E6N3X3
gi|557693448|ref|YP_008796502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]