SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557693458|ref|YP_008796512.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693458|ref|YP_008796512.1|
Domain Number 1 Region: 169-358
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.73e-63
Family Actin/HSP70 0.00000286
Further Details:      
 
Domain Number 2 Region: 364-519
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.29e-59
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000507
Further Details:      
 
Domain Number 3 Region: 4-163
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.44e-50
Family Actin/HSP70 0.0000091
Further Details:      
 
Domain Number 4 Region: 513-586
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000863
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557693458|ref|YP_008796512.1|
Sequence length 592
Comment molecular chaperone DnaK [Candidatus Caldiarchaeum subterraneum]
Sequence
MAEKIIGIDLGTSNSAAAVVIGGRPTIIPSVEGVTLYGKAFPSYVAITKEGDLLVGEPAR
RQAVLNPEGTVTAWKRRMGTDYRYNLHGKEFTPQQLSAFLLQKIKRDAEAFLGEPVKKAV
ITVPAYFNDNQRQATKDAGVIAGLEVVRIINEPTAAALAYGLNKLDQEMKILVFDLGGGT
LDVTIMEFGQGVFEVLATAGDTQLGGTDMDKALVDYIVDTYRRETGIDLSNDKSAMNRIR
EAAERAKIELSSMTETEINLPYIAYDSSGPKNLYMRINRATLEQLVKPIVERCRGPVMQA
LQDAKLKPEEIDKIILVGGPTRMPIIQQFIKEVLGKEPERGVDPMECVAMGAAIQAAIIS
GEMKDKDIVLLDVVPISLGVETLGGIFTKIIERNTTIPVRRSEIFTTAADFQTSVEIHVL
QGERPMAADNVSLGRFTLSGIPPAPRGVPKIEVTFDINADGILTVTAKDLGTGKDVSVKI
TAPHRLSKEEVERMIREAEQFAEQDRRKKQEAELRNEADGLIYTVEKALKEFGDKVSPEA
KKEVEDDLAKLKEALAGKDIQAIKTALEKLRASAQKIGTAVYGQREDQQKKS
Download sequence
Identical sequences A0A2H5V716 E6N439
gi|557693458|ref|YP_008796512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]