SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557693570|ref|YP_008796624.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693570|ref|YP_008796624.1|
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-61
Family Phosphate binding protein-like 0.00017
Further Details:      
 
Domain Number 2 Region: 175-270
Classification Level Classification E-value
Superfamily ACT-like 5.19e-31
Family Phenylalanine metabolism regulatory domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557693570|ref|YP_008796624.1|
Sequence length 276
Comment chorismate mutase / prephenate dehydratase [Candidatus Caldiarchaeum subterraneum]
Sequence
MHTTVAFQGEKGAYSEEAIFHFFGENVQTMPCKSIRDVFKNCEARVVDYGVVPVENSIEG
SVFETYDMFLSSSVKAVGEIILRIRHCLIALPDVSLSEVETVYSHPQALAQCRGYLQSLG
VSVEVTYDTAGSVKMIKERGLRNAAAVASERAAEIYGMKILAKGIEDYGHNYTRFLVISV
KEAQYSPSSKTSIIFSTAHKPGALYNALGAFARNGINLTKIESRPTRQRPWEYYFFVDFE
GHQEEEHVKKALAELVSYTSFIKILGSYPRASTELS
Download sequence
Identical sequences A0A2H5V7A9 E6P7T3
gi|557693570|ref|YP_008796624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]