SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557693609|ref|YP_008796663.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693609|ref|YP_008796663.1|
Domain Number 1 Region: 359-482
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000000188
Family MJ1460-like 0.0081
Further Details:      
 
Weak hits

Sequence:  gi|557693609|ref|YP_008796663.1|
Domain Number - Region: 85-174
Classification Level Classification E-value
Superfamily Holliday junction resolvase RusA 0.0445
Family Holliday junction resolvase RusA 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557693609|ref|YP_008796663.1|
Sequence length 485
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MANTELEKTLFPTGHQVFDRIVYFRHGMTVLVTDETFSEARAFLRTLLKKHQQSIIELVS
TRNPQTEQVPVPIEALQDLSINVNQKRRAEKNRIFIHNYLPELLIRHNGDEVLKLLEMWQ
KDVANAGNLEFYLLPRNTFADFEKKAKAIVDAVIEIHVVKENNQFLYYFTPIRSCSQAHH
LKNIRYEIKEGQLLIEWENILISDLPAEPISRKQLRDQLESNEDRILIKLGKIDPRNFTV
EDYALLTSLDNIRLLDAKLLFPDRWPEVFDKIIEWILAGALKTEETKPAKKYARRQKLKF
KNKLLLNVPTRLSLMLVSLSKGFLGKRVRTVPLDAHLAVLEAVKNIVDMLASDRPEIRRD
ARFATRYFGELSARKTALEYIMRLEGTPYTSFSVKHVPSLISITLKAGWGLDVNFITSSG
EIWLFEVRNCHLCGDAVSDEPFCDKFVSSVVVGVLSVCLKRRFECFEVSCKAVGNESCIF
KAYKV
Download sequence
Identical sequences E6N4G0 H5SJ39
gi|557693609|ref|YP_008796663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]