SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557693651|ref|YP_008796705.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693651|ref|YP_008796705.1|
Domain Number 1 Region: 199-393
Classification Level Classification E-value
Superfamily Kelch motif 8.5e-50
Family Kelch motif 0.00011
Further Details:      
 
Domain Number 2 Region: 114-243
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.62e-20
Family Galactose oxidase, central domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557693651|ref|YP_008796705.1|
Sequence length 400
Comment kelch repeat protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MMVIQQIFNNTPPSLSLAALRRRQVLGVAASVAAAGAFYLIYSFSGPVREQRPTSGATET
TTMTPYHTTQNTATDTSLTTPATTVVQQPHHTTQVTAKETSTTTAATTGIQPRWLVEEPL
PMALTEVAMVSDGKSLFLAGGLTAEGNASSHFFSYNVELKKWRELAPMPAPLHHVGLVYL
NNRVYLLGGYDNRWNAQRKAYAYRVNRDVWEELSPLPVARAALTAQAVKDVLYAVGGARG
NMPLNINEAYDPTSNEWKPMAPMSIAREHLTSGAVEGKMYAIGGRVVSANTMTNLNVVEE
YDVEKNVWRFRKPMPTARSGLAAAVVGGLIYVCGGESQVKTFGEVEAYDPVSDTWLKVAE
MVTPRHGLGVAAAGDKIFTVAGGPRPGLYVSDVNEALALG
Download sequence
Identical sequences E6N4G9
gi|557693651|ref|YP_008796705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]