SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557693780|ref|YP_008796834.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693780|ref|YP_008796834.1|
Domain Number 1 Region: 221-374
Classification Level Classification E-value
Superfamily SIS domain 2.43e-21
Family mono-SIS domain 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|557693780|ref|YP_008796834.1|
Domain Number - Region: 11-154
Classification Level Classification E-value
Superfamily SIS domain 0.0311
Family mono-SIS domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557693780|ref|YP_008796834.1|
Sequence length 385
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MSETVSSLGYVNRIYRNVSAVDLDSLERLLHDIQSAGVIIPLGEGRSKGALSIAVSEMAK
MRDGKIVIDRGDVGFPGREISEAAPILKQRFGRVCLLINSGSGRSITPLVDAQNLASYIG
KTGAHRDYTIDLVTSDIQSPLAKIASKYGNVLHLMGREEVAEAEEAKVFRDVGIMEDTFI
LGSGVLFHAIAEALYDKALPSKAYEYAREICLEAGKVVEKSLTSEFYEFVTRKLETRSLC
FFGGLGSSYEVARMTAVRVSHIKRAIGDQVYVARESSTPAPRQGDLLIVISSSGETEIVS
TWCKSFKRMGGQIAAVVGNADSTIASMADSVLEIPVKNELGRPNRFYVYAEFALSPLPIL
LVESLEAKGFRLPEYILRWHQSVTA
Download sequence
Identical sequences E6N4Y4
gi|557693780|ref|YP_008796834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]