SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557693901|ref|YP_008796955.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693901|ref|YP_008796955.1|
Domain Number 1 Region: 88-186
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 9.16e-23
Family Ribosomal protein S3 C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 12-95
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.1e-18
Family Prokaryotic type KH domain (KH-domain type II) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557693901|ref|YP_008796955.1|
Sequence length 203
Comment small subunit ribosomal protein S3 [Candidatus Caldiarchaeum subterraneum]
Sequence
MTLVKQILETRIKKADIEEYLREKLKNAFFGGVSISFTPLGTRVTIYAMRPSRVIGPKGK
VIKEITEALEKQFGVENPVVTVVEVEVPELNPYVMAERIAQDLARGLRYRRVGFWAVKRI
MEAGAKGVEVHISGKLTSARSRTEKFTEGFMPKSGELAMNYVLEGKSSVLLKTGLFGVRV
LIYPPDAPLPEEIKVKQIEAPRA
Download sequence
Identical sequences A0A2H5V6K0 E6N5E0
gi|557693901|ref|YP_008796955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]