SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557693944|ref|YP_008796998.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693944|ref|YP_008796998.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.00000000000000916
Family MazG-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557693944|ref|YP_008796998.1|
Sequence length 113
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MRLSELQKRVEEFEKARGWDSFRESLIYAHLIEEITEIGRFILEKEGYKRSGLGHSSPGE
DLDSEFAQSLTLFVQLANRFGVDLEKALAKEMAKMEKRFNAEEWRKALGRDGS
Download sequence
Identical sequences A0A2H5V6P3 E6N5L7
gi|557693944|ref|YP_008796998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]