SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557693975|ref|YP_008797029.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557693975|ref|YP_008797029.1|
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000051
Family Multidrug resistance efflux transporter EmrE 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557693975|ref|YP_008797029.1|
Sequence length 133
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MFALIAFLCLGLTDFFRKKGAAAGANSFSYLLVETVVLLALLPIVAMVYSGKLTLSFSGA
IPYALLSGVTITVALVAMLSGLSIGEGSLVIPISRLGLALATLLSLFFLNESITLTKVLG
IGLAVAAVFLLSR
Download sequence
Identical sequences E6N5N3
gi|557693975|ref|YP_008797029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]