SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694098|ref|YP_008797152.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694098|ref|YP_008797152.1|
Domain Number 1 Region: 154-376
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 2.75e-54
Family Creatinase/aminopeptidase 0.0000302
Further Details:      
 
Domain Number 2 Region: 10-151
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 6.98e-24
Family Creatinase/prolidase N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694098|ref|YP_008797152.1|
Sequence length 377
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MPWSEGPRLRWRRLLQWMERQQLDMVVLGSQKNIYYITGYITARIFMPAFLFIPIDGEPL
LVTGKSDSEQAAKTFGGEIVEYVNYNLDNVMRPYPIHGVEAAVKTLRSRQPKIKKLGYEG
WALDAVILHEMLKMYPTAEFTDVSENILLMRKSKDEDELQNLREAAKLNDYAYRVAKENT
TVGRSEAELYTIIHSELVKKKSGFQFFSGDFVSGERCLQIGGPPTNRRLQMGETLILDLW
VTHQEYWSDTCRTFVVGSVPSALQKKVFEVLKEALKAGEAALKPGATGSDVYRAVYGAID
RHGYGKYFPHHAGHALGLEAWEPPYFIPGDKNIITENTVCALEPGIYFGDVGGVRLENNY
VVKRGGVEVLNEFPLDP
Download sequence
Identical sequences E6N5Y7
gi|557694098|ref|YP_008797152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]