SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694103|ref|YP_008797157.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694103|ref|YP_008797157.1|
Domain Number 1 Region: 19-249
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.54e-41
Family Alanine racemase-like, N-terminal domain 0.033
Further Details:      
 
Weak hits

Sequence:  gi|557694103|ref|YP_008797157.1|
Domain Number - Region: 289-337
Classification Level Classification E-value
Superfamily GroES-like 0.0114
Family Alcohol dehydrogenase-like, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557694103|ref|YP_008797157.1|
Sequence length 366
Comment alanine racemase domain protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MLMFSSMRRGDIDTPALIVDVKVLKRNITEMADFARSLGKKLRPHVKTHKTPEIAWMQME
AGADGICVQKLGEAEVMAEAGLDDILVSNEVVGVQKMHRLVKLAEKVKLSVAVDDVENVS
ELGRFCRENGVEVGVYVDVDCGMHRTGVPPEKAWLLAEKVTRTEGVYLVGLMGYEGHAGS
PTSREERHKLIEEAVKATLHAAKLMKNNGIEPGEVSMGSSATVRVSGRYEGVTELQPGMY
VFNDWYLVEREAATQETCALHVLTTVMSKTSPERCVVDAGSKAFHLDMGRYPVCVGVEGV
EIYKLSEEHGWVKLSGKAVDKVKLGDRLEFIPYHVCPCVNQFDIMYGLEGDSVTKIWEIK
ARGKVT
Download sequence
Identical sequences E6N5Z2
gi|557694103|ref|YP_008797157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]