SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694332|ref|YP_008797386.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694332|ref|YP_008797386.1|
Domain Number 1 Region: 19-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.25e-21
Family GHMP Kinase, N-terminal domain 0.0043
Further Details:      
 
Domain Number 2 Region: 166-279
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000000000899
Family Homoserine kinase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694332|ref|YP_008797386.1|
Sequence length 287
Comment shikimate kinase [Candidatus Caldiarchaeum subterraneum]
Sequence
MKGRGRAGGAVSIVNAISTGFGAALGIDLQTEAELETTDEPHIKLSINGEDADPSLAKAV
IKVFSLALDVNVNGAVIRTYSNIPVAVGLKSSSSAAVAIANAFLDALGEKMSADEMLRNV
AEASILSGTSITGALDDAAACMLGGIVATDNHGRKILKHVLIEEKLYAVIYVPPGKTYTA
SFRKELLTPIRNIAAAAFTLALEGKHWEAMTINGLAHSAALGLPIEPAVNALRAGACAAG
LSGTGPAVAAIVAEEWVDNVADVFSAYEGKIVKTSVNRGRTVDICPC
Download sequence
Identical sequences E6N6H8
gi|557694332|ref|YP_008797386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]