SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694352|ref|YP_008797406.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|557694352|ref|YP_008797406.1|
Domain Number - Region: 138-212
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0455
Family Ubiquitin-related 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557694352|ref|YP_008797406.1|
Sequence length 215
Comment hypothetical protein CSUB_C0919 [Candidatus Caldiarchaeum subterraneum]
Sequence
MVIKKIYGSSDESPAKSTIYNYLKMLEKGLPAKRFRILCKIPLIKNIRLRPLFLKKAGDS
ILVYAPDNFLGKESAGILLWIAIIMLYAFTGYLSSDPQLITYALLFYFVLSAGVAIRILA
SYLYLRSNGIYRKWEIKVAVDGKTSVEGSFNGNITLKEIMEWALAKIYSSSVYRKPENYL
IYFGNKQLSPQLRLYQTNLPTHLTFTLTRIKRTQS
Download sequence
Identical sequences E6N6M3
gi|557694352|ref|YP_008797406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]