SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694508|ref|YP_008797562.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694508|ref|YP_008797562.1|
Domain Number 1 Region: 6-214
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.82e-64
Family FAD-linked oxidases, N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 219-457
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.29e-60
Family Vanillyl-alcohol oxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|557694508|ref|YP_008797562.1|
Sequence length 464
Comment glycolate oxidase [Candidatus Caldiarchaeum subterraneum]
Sequence
MDFGKVAEELRLLLGDDKVFTDEESLDKYSRDMGGFMRRPKLVVRASCVEDVSKLLRYCS
RHKIPLTVWGAGTSLTGAVVTDSLILDLSAMTRILKVDTVNYYAHVEAGVVLEQLNNTLE
EYGFFFPPDPASSFLCTVGGAVAEGSGGLRCVKYGTVKDWVLAVKVVLASGDVVVFGEPL
AKNRAGYNLCQLMVGSEGTLGVIVEAWLKIAPLPEFGIRRIYAVFDDWRDAGRAIIEIRT
NRVVPRMLEFFDRIGLEAANKMHGTSLPVGEAMLLIDVEEMTGKELPKVLQILEKNHARE
VRVAETEEEAEQLLQIRATMYLAIRSVTKEVMVEDVCVPIDRIVDYLEKVQELSRKHGLT
ISMNGHAGDGNIHPLIFYDPDNPEEVKRAEQAVRDLVRFAIEVGGTITGEHGVGIQKMRE
LVQQLEAHNGIETLKLMQKIKKAFDPDNILNPGKYIDVSWMQSQ
Download sequence
Identical sequences E6N788
gi|557694508|ref|YP_008797562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]