SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694568|ref|YP_008797622.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694568|ref|YP_008797622.1|
Domain Number 1 Region: 139-263
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000000000214
Family MJ1460-like 0.016
Further Details:      
 
Domain Number 2 Region: 24-101
Classification Level Classification E-value
Superfamily ACT-like 0.0000000115
Family IlvH-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694568|ref|YP_008797622.1|
Sequence length 268
Comment conserved hypothetical protein [Candidatus Caldiarchaeum subterraneum]
Sequence
MTQAVVRSPIDSPRAIYCGDRELYLFSVELVDRPGSLAEVLAVFATYGVNIVNIYTTQSI
YTDTSSTVEANIAADLTGKNVSSEQLAKSINLLNSVKRVTVVSKQLPNILVDELHFPLRV
VGDRAVIYRDGAYGEMIHAIRRQLGTAGEALLYHIGFSIGKGAWKKIKEICGEKMHLLPK
YIQYWNLVHSAARIIHIEIDFEKKDFLIRAESVYECEVGRGHGKPFSNIFRGSLAGILNE
ALGVETVVETKCIAAGDPYCEFVPAKRP
Download sequence
Identical sequences E6N7F4
gi|557694568|ref|YP_008797622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]