SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557694688|ref|YP_008797742.1| from Candidatus Caldiarchaeum subterraneum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557694688|ref|YP_008797742.1|
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000044
Family GHMP Kinase, N-terminal domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|557694688|ref|YP_008797742.1|
Domain Number - Region: 185-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0153
Family Homoserine kinase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557694688|ref|YP_008797742.1|
Sequence length 311
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase [Candidatus Caldiarchaeum subterraneum]
Sequence
MIVEVEAYARLHMGLFELGQHFGRRWGGVGVSIKQPSLRVTVNTESSEQVEGIDSEEAEN
VVTLLCRSLGKKFKGGIKVQSGIPVHRGFGSRTQLRLALATAICKAMDVEFQVHRIAEVL
GIGEVSSVGTHLFANGGLVVQLPRQANRTGLGSFIRLEFPEDWWFVVAYPGDVMGLDEQQ
ERRLFATLPPQEPLTCMEISHLILGCLLPTLLERDLTGFGECLSILQRLVGQYFASVQGG
VFRMAEAVQLLRMAGAKGVGQSSWGPAVYGLFGDRLEAENAVFEVRKHLGDNWNVYATTA
VNHGARVSVRP
Download sequence
Identical sequences E6N7Q8
gi|557694688|ref|YP_008797742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]